Paramormyrops kingsleyae: 111853919 Help Entry 111853919         CDS       T05788                                  Name (RefSeq) myosin light polypeptide 6-like   KO K12751   myosin light chain 6 Organism pki  Paramormyrops kingsleyae Pathway pki04270   Vascular smooth muscle contraction pki04517   IgSF CAM signaling pki04530   Tight junction pki04814   Motor proteins Brite KEGG Orthology (KO) [BR:pki00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     111853919  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     111853919   09142 Cell motility    04814 Motor proteins     111853919  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     111853919  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pki04812]     111853919    04147 Exosome [BR:pki04147]     111853919 Cytoskeleton proteins [BR:pki04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      111853919 Exosome [BR:pki04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111853919   Exosomal proteins of bladder cancer cells    111853919 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_6 EF-hand_1 EF-hand_7 AIF-1 EF_EFCAB10_C EF-hand_5 Motif Other DBs NCBI-GeneID:  111853919 NCBI-ProteinID:  XP_023687118 Ensembl:  ENSPKIG00000008811 UniProt:  A0A3B3S694 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MSDFSEDQILEFKEAFLLFDRTGDGKISYSQCGDVMRALGQNPVNAEVLKVLGNPKAEEM NHKMLDFEQFLPMLQAIAKNKDQGSFEDIVEGLRVFDKEGNGTVMGAELRHVLTTLGEKM TEEEVETLLAGHEDANGCINYEDLLRMVMSG NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtctgacttttctgaggaccaaattcttgagttcaaggaggcgttcttattgtttgac cggacaggcgatggcaagattagctacagccagtgtggggatgtgatgcgtgcgttaggc cagaacccagtcaatgccgaggtgcttaaggttctgggcaaccccaaagctgaggaaatg aatcacaaaatgctggactttgagcagttcctgcccatgctacaagccattgctaaaaac aaggaccagggctcgtttgaggatatcgtggagggcttgcgtgtcttcgacaaggagggc aatggcaccgtcatgggggcggagctccggcacgtcctgaccacactgggggagaagatg acagaggaggaggtagaaactcttttggcaggacatgaagatgccaatggctgcatcaat tacgaagatctcctccggatggtcatgagtggttga

DBGET integrated database retrieval system