Paramormyrops kingsleyae: 111855859 Help Entry 111855859         CDS       T05788                                  Symbol rhoa Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism pki  Paramormyrops kingsleyae Pathway pki04081   Hormone signaling pki04144   Endocytosis pki04150   mTOR signaling pathway pki04270   Vascular smooth muscle contraction pki04310   Wnt signaling pathway pki04350   TGF-beta signaling pathway pki04510   Focal adhesion pki04517   IgSF CAM signaling pki04519   Cadherin signaling pki04520   Adherens junction pki04530   Tight junction pki04621   NOD-like receptor signaling pathway pki04625   C-type lectin receptor signaling pathway pki04810   Regulation of actin cytoskeleton pki05100   Bacterial invasion of epithelial cells pki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pki00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     111855859 (rhoa)    04350 TGF-beta signaling pathway     111855859 (rhoa)    04150 mTOR signaling pathway     111855859 (rhoa)   09133 Signaling molecules and interaction    04081 Hormone signaling     111855859 (rhoa)    04517 IgSF CAM signaling     111855859 (rhoa)    04519 Cadherin signaling     111855859 (rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111855859 (rhoa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     111855859 (rhoa)    04520 Adherens junction     111855859 (rhoa)    04530 Tight junction     111855859 (rhoa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     111855859 (rhoa)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     111855859 (rhoa)    04625 C-type lectin receptor signaling pathway     111855859 (rhoa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     111855859 (rhoa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111855859 (rhoa)    05100 Bacterial invasion of epithelial cells     111855859 (rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pki04131]     111855859 (rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pki04147]     111855859 (rhoa)    04031 GTP-binding proteins [BR:pki04031]     111855859 (rhoa) Membrane trafficking [BR:pki04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     111855859 (rhoa) Exosome [BR:pki04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111855859 (rhoa)   Exosomal proteins of other body fluids (saliva and urine)    111855859 (rhoa)   Exosomal proteins of colorectal cancer cells    111855859 (rhoa)   Exosomal proteins of bladder cancer cells    111855859 (rhoa) GTP-binding proteins [BR:pki04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     111855859 (rhoa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  111855859 NCBI-ProteinID:  XP_023691108 Ensembl:  ENSPKIG00000013242 UniProt:  A0A3B3SS93 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELNKMKQEPVKPEEGRDMANRISAFGYMECSAKTTEGVREVFEMATRAALQ ARRGKKSSKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaatcagaaaaaaactggtaattgttggggatggtgcatgtgggaagacctgt ttgctcatcgtcttcagtaaagaccagttccctgaagtgtatgtgcccacggtcttcgag aactatgtggccgacatcgaggtggatggcaaacaggtggaactggcactatgggataca gcaggacaagaggactatgaccggcttcgtcccctctcataccctgacactgatgtaatc cttatgtgcttctctattgacagtcctgacagcttagaaaacatcccagagaagtggact cctgaagtaaagcatttctgtcccaatgttccaatcattcttgtgggcaacaagaaggac ctgcgtaatgatgaacatactcgccgtgagctgaataagatgaagcaggagcctgtaaaa cctgaagaaggcagagacatggcaaaccggatcagtgcttttggttacatggaatgttct gcgaagaccacggaaggtgtgcgagaagtgtttgaaatggccaccagagcagcactgcag gcacggagaggaaagaagagcagcaaatgccttcttttgtag

DBGET integrated database retrieval system