Paramormyrops kingsleyae: 111859528 Help Entry 111859528         CDS       T05788                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism pki  Paramormyrops kingsleyae Pathway pki04010   MAPK signaling pathway pki04012   ErbB signaling pathway pki04068   FoxO signaling pathway pki04137   Mitophagy - animal pki04140   Autophagy - animal pki04144   Endocytosis pki04150   mTOR signaling pathway pki04210   Apoptosis pki04218   Cellular senescence pki04370   VEGF signaling pathway pki04371   Apelin signaling pathway pki04510   Focal adhesion pki04540   Gap junction pki04625   C-type lectin receptor signaling pathway pki04810   Regulation of actin cytoskeleton pki04910   Insulin signaling pathway pki04912   GnRH signaling pathway pki04916   Melanogenesis pki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pki00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111859528 (hras)    04012 ErbB signaling pathway     111859528 (hras)    04370 VEGF signaling pathway     111859528 (hras)    04371 Apelin signaling pathway     111859528 (hras)    04068 FoxO signaling pathway     111859528 (hras)    04150 mTOR signaling pathway     111859528 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111859528 (hras)    04140 Autophagy - animal     111859528 (hras)    04137 Mitophagy - animal     111859528 (hras)   09143 Cell growth and death    04210 Apoptosis     111859528 (hras)    04218 Cellular senescence     111859528 (hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     111859528 (hras)    04540 Gap junction     111859528 (hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     111859528 (hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111859528 (hras)   09152 Endocrine system    04910 Insulin signaling pathway     111859528 (hras)    04912 GnRH signaling pathway     111859528 (hras)    04916 Melanogenesis     111859528 (hras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111859528 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pki04131]     111859528 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pki04147]     111859528 (hras)    04031 GTP-binding proteins [BR:pki04031]     111859528 (hras) Membrane trafficking [BR:pki04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     111859528 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     111859528 (hras) Exosome [BR:pki04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    111859528 (hras)   Exosomal proteins of colorectal cancer cells    111859528 (hras) GTP-binding proteins [BR:pki04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111859528 (hras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  111859528 NCBI-ProteinID:  XP_023698056 Ensembl:  ENSPKIG00000000303 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CLNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtggtgggcgctgggggcgtgggcaagagtgccctcacc atccagcttatccagaaccactttgtggacgagtatgaccccaccatcgaggactcatac aggaagcaggtggtgattgatggggagacgtgtcttctggacatcttggacacagctgga caggaagagtacagcgccatgcgggaccagtatatgaggaccggggagggcttcctctgt gtctttgccatcaacaacaccaagtccttcgaagacattcatcagtacagggagcagatc aagcgggtgaaggactcggacgatgtgcccatggtgctggtggggaacaaatgcgacctg ccggcccgcacggtggacacccgccaggcgcaggagctggcccgcagctacggcatcccc tacatcgagacctcagccaagacgagacagggggtggaggacgctttctataccttggtg cgtgagatccgacagcataagctccggaagctgaacccaccagacgagagcggccaggac tgtctgaactgccgttgtgtggtgtcgtga

DBGET integrated database retrieval system