Paramormyrops kingsleyae: 111861082 Help Entry 111861082         CDS       T05788                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism pki  Paramormyrops kingsleyae Pathway pki03030   DNA replication pki03410   Base excision repair pki03420   Nucleotide excision repair pki03430   Mismatch repair pki03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pki00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     111861082 (pold4)    03410 Base excision repair     111861082 (pold4)    03420 Nucleotide excision repair     111861082 (pold4)    03430 Mismatch repair     111861082 (pold4)    03440 Homologous recombination     111861082 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pki03032]     111861082 (pold4)    03400 DNA repair and recombination proteins [BR:pki03400]     111861082 (pold4) DNA replication proteins [BR:pki03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     111861082 (pold4) DNA repair and recombination proteins [BR:pki03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       111861082 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      111861082 (pold4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  111861082 NCBI-ProteinID:  XP_023701168 Ensembl:  ENSPKIG00000015257 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MSPKRRLITDSFKVVKRTRTSDKRGKSPVPEQEAEPDPLTPREKDLLQLRKFDLDWRYGP CTGISRIQRWERAQLHGLTPPADVRELLLKGDDDPDYSHCLWRDYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgtctccaaaacgcagactgattaccgactctttcaaagtggtgaagagaacgaggacg tccgataaaagaggaaaatccccagtcccagagcaggaggcggagcccgaccccttgaca ccgcgagaaaaggacctgctccaactaaggaagtttgacctcgactggcgctatggacca tgcacagggatcagccgtatccagcgttgggagagggctcagctgcatggtctaaccccc ccagcggacgtacgggagctgctgctgaagggcgatgatgatccagactattcccactgc ctgtggcgggattacccactctga

DBGET integrated database retrieval system