Pseudomonas kielensis: Q1W70_11395 Help Entry Q1W70_11395       CDS       T09328                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pkj  Pseudomonas kielensis Brite KEGG Orthology (KO) [BR:pkj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pkj03036]     Q1W70_11395 Chromosome and associated proteins [BR:pkj03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Q1W70_11395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 SOGA1-2-like_CC ZapB Motif Other DBs NCBI-ProteinID:  WKL55126 LinkDB All DBs Position complement(2461307..2461516) Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMARLELLITRVEQLKGQNGLLLAQEKTWREERAHLIEKNDIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatggccagactcgaactgctaattacccgggtc gagcaacttaagggccaaaacggactcttattagctcaggaaaagacctggcgcgaggaa cgcgcgcacctcattgaaaaaaatgacatcgcccggcgtaaggtcgaatcgatgatttcg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system