Pseudomonas kurunegalensis: QQ992_27010 Help Entry QQ992_27010       CDS       T09327                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pkk  Pseudomonas kurunegalensis Brite KEGG Orthology (KO) [BR:pkk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pkk03036]     QQ992_27010 Chromosome and associated proteins [BR:pkk03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     QQ992_27010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 YebO ZapB Motif Other DBs NCBI-ProteinID:  WJD65437 LinkDB All DBs Position 5935853..5936035 Genome browser AA seq 60 aa AA seqDB search MSRFELLIERVEQLKRQNALLVAQEKSWREERAHLIEKNEIAKRKVESMILRLKALEQDS NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgagccgattcgagttgctgatcgaacgcgtcgagcaactaaaacggcaaaatgcactc ctagtagcgcaggaaaaatcctggcgcgaagagcgcgcccacctcatcgaaaagaacgag atcgccaagcgcaaagtcgagtcgatgattttacgcctcaaggctctggagcaagactca tga

DBGET integrated database retrieval system