KEGG   Pipistrellus kuhlii (Kuhl's pipistrelle): 118704886
Entry
118704886         CDS       T07682                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pkl  Pipistrellus kuhlii (Kuhl's pipistrelle)
Pathway
pkl01521  EGFR tyrosine kinase inhibitor resistance
pkl01522  Endocrine resistance
pkl01524  Platinum drug resistance
pkl04010  MAPK signaling pathway
pkl04012  ErbB signaling pathway
pkl04014  Ras signaling pathway
pkl04015  Rap1 signaling pathway
pkl04022  cGMP-PKG signaling pathway
pkl04024  cAMP signaling pathway
pkl04062  Chemokine signaling pathway
pkl04066  HIF-1 signaling pathway
pkl04068  FoxO signaling pathway
pkl04071  Sphingolipid signaling pathway
pkl04072  Phospholipase D signaling pathway
pkl04114  Oocyte meiosis
pkl04140  Autophagy - animal
pkl04148  Efferocytosis
pkl04150  mTOR signaling pathway
pkl04151  PI3K-Akt signaling pathway
pkl04210  Apoptosis
pkl04218  Cellular senescence
pkl04261  Adrenergic signaling in cardiomyocytes
pkl04270  Vascular smooth muscle contraction
pkl04350  TGF-beta signaling pathway
pkl04360  Axon guidance
pkl04370  VEGF signaling pathway
pkl04371  Apelin signaling pathway
pkl04380  Osteoclast differentiation
pkl04510  Focal adhesion
pkl04520  Adherens junction
pkl04540  Gap junction
pkl04550  Signaling pathways regulating pluripotency of stem cells
pkl04611  Platelet activation
pkl04613  Neutrophil extracellular trap formation
pkl04620  Toll-like receptor signaling pathway
pkl04621  NOD-like receptor signaling pathway
pkl04625  C-type lectin receptor signaling pathway
pkl04650  Natural killer cell mediated cytotoxicity
pkl04657  IL-17 signaling pathway
pkl04658  Th1 and Th2 cell differentiation
pkl04659  Th17 cell differentiation
pkl04660  T cell receptor signaling pathway
pkl04662  B cell receptor signaling pathway
pkl04664  Fc epsilon RI signaling pathway
pkl04666  Fc gamma R-mediated phagocytosis
pkl04668  TNF signaling pathway
pkl04713  Circadian entrainment
pkl04720  Long-term potentiation
pkl04722  Neurotrophin signaling pathway
pkl04723  Retrograde endocannabinoid signaling
pkl04724  Glutamatergic synapse
pkl04725  Cholinergic synapse
pkl04726  Serotonergic synapse
pkl04730  Long-term depression
pkl04810  Regulation of actin cytoskeleton
pkl04910  Insulin signaling pathway
pkl04912  GnRH signaling pathway
pkl04914  Progesterone-mediated oocyte maturation
pkl04915  Estrogen signaling pathway
pkl04916  Melanogenesis
pkl04917  Prolactin signaling pathway
pkl04919  Thyroid hormone signaling pathway
pkl04921  Oxytocin signaling pathway
pkl04926  Relaxin signaling pathway
pkl04928  Parathyroid hormone synthesis, secretion and action
pkl04929  GnRH secretion
pkl04930  Type II diabetes mellitus
pkl04933  AGE-RAGE signaling pathway in diabetic complications
pkl04934  Cushing syndrome
pkl04935  Growth hormone synthesis, secretion and action
pkl04960  Aldosterone-regulated sodium reabsorption
pkl05010  Alzheimer disease
pkl05020  Prion disease
pkl05022  Pathways of neurodegeneration - multiple diseases
pkl05034  Alcoholism
pkl05132  Salmonella infection
pkl05133  Pertussis
pkl05135  Yersinia infection
pkl05140  Leishmaniasis
pkl05142  Chagas disease
pkl05145  Toxoplasmosis
pkl05152  Tuberculosis
pkl05160  Hepatitis C
pkl05161  Hepatitis B
pkl05163  Human cytomegalovirus infection
pkl05164  Influenza A
pkl05165  Human papillomavirus infection
pkl05166  Human T-cell leukemia virus 1 infection
pkl05167  Kaposi sarcoma-associated herpesvirus infection
pkl05170  Human immunodeficiency virus 1 infection
pkl05171  Coronavirus disease - COVID-19
pkl05200  Pathways in cancer
pkl05203  Viral carcinogenesis
pkl05205  Proteoglycans in cancer
pkl05206  MicroRNAs in cancer
pkl05207  Chemical carcinogenesis - receptor activation
pkl05208  Chemical carcinogenesis - reactive oxygen species
pkl05210  Colorectal cancer
pkl05211  Renal cell carcinoma
pkl05212  Pancreatic cancer
pkl05213  Endometrial cancer
pkl05214  Glioma
pkl05215  Prostate cancer
pkl05216  Thyroid cancer
pkl05218  Melanoma
pkl05219  Bladder cancer
pkl05220  Chronic myeloid leukemia
pkl05221  Acute myeloid leukemia
pkl05223  Non-small cell lung cancer
pkl05224  Breast cancer
pkl05225  Hepatocellular carcinoma
pkl05226  Gastric cancer
pkl05230  Central carbon metabolism in cancer
pkl05231  Choline metabolism in cancer
pkl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pkl05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pkl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    118704886 (MAPK3)
   04012 ErbB signaling pathway
    118704886 (MAPK3)
   04014 Ras signaling pathway
    118704886 (MAPK3)
   04015 Rap1 signaling pathway
    118704886 (MAPK3)
   04350 TGF-beta signaling pathway
    118704886 (MAPK3)
   04370 VEGF signaling pathway
    118704886 (MAPK3)
   04371 Apelin signaling pathway
    118704886 (MAPK3)
   04668 TNF signaling pathway
    118704886 (MAPK3)
   04066 HIF-1 signaling pathway
    118704886 (MAPK3)
   04068 FoxO signaling pathway
    118704886 (MAPK3)
   04072 Phospholipase D signaling pathway
    118704886 (MAPK3)
   04071 Sphingolipid signaling pathway
    118704886 (MAPK3)
   04024 cAMP signaling pathway
    118704886 (MAPK3)
   04022 cGMP-PKG signaling pathway
    118704886 (MAPK3)
   04151 PI3K-Akt signaling pathway
    118704886 (MAPK3)
   04150 mTOR signaling pathway
    118704886 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    118704886 (MAPK3)
   04148 Efferocytosis
    118704886 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    118704886 (MAPK3)
   04210 Apoptosis
    118704886 (MAPK3)
   04218 Cellular senescence
    118704886 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    118704886 (MAPK3)
   04520 Adherens junction
    118704886 (MAPK3)
   04540 Gap junction
    118704886 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    118704886 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118704886 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    118704886 (MAPK3)
   04613 Neutrophil extracellular trap formation
    118704886 (MAPK3)
   04620 Toll-like receptor signaling pathway
    118704886 (MAPK3)
   04621 NOD-like receptor signaling pathway
    118704886 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    118704886 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    118704886 (MAPK3)
   04660 T cell receptor signaling pathway
    118704886 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    118704886 (MAPK3)
   04659 Th17 cell differentiation
    118704886 (MAPK3)
   04657 IL-17 signaling pathway
    118704886 (MAPK3)
   04662 B cell receptor signaling pathway
    118704886 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    118704886 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    118704886 (MAPK3)
   04062 Chemokine signaling pathway
    118704886 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    118704886 (MAPK3)
   04929 GnRH secretion
    118704886 (MAPK3)
   04912 GnRH signaling pathway
    118704886 (MAPK3)
   04915 Estrogen signaling pathway
    118704886 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    118704886 (MAPK3)
   04917 Prolactin signaling pathway
    118704886 (MAPK3)
   04921 Oxytocin signaling pathway
    118704886 (MAPK3)
   04926 Relaxin signaling pathway
    118704886 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    118704886 (MAPK3)
   04919 Thyroid hormone signaling pathway
    118704886 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    118704886 (MAPK3)
   04916 Melanogenesis
    118704886 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    118704886 (MAPK3)
   04270 Vascular smooth muscle contraction
    118704886 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    118704886 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    118704886 (MAPK3)
   04725 Cholinergic synapse
    118704886 (MAPK3)
   04726 Serotonergic synapse
    118704886 (MAPK3)
   04720 Long-term potentiation
    118704886 (MAPK3)
   04730 Long-term depression
    118704886 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    118704886 (MAPK3)
   04722 Neurotrophin signaling pathway
    118704886 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    118704886 (MAPK3)
   04380 Osteoclast differentiation
    118704886 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    118704886 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118704886 (MAPK3)
   05206 MicroRNAs in cancer
    118704886 (MAPK3)
   05205 Proteoglycans in cancer
    118704886 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    118704886 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    118704886 (MAPK3)
   05203 Viral carcinogenesis
    118704886 (MAPK3)
   05230 Central carbon metabolism in cancer
    118704886 (MAPK3)
   05231 Choline metabolism in cancer
    118704886 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    118704886 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    118704886 (MAPK3)
   05212 Pancreatic cancer
    118704886 (MAPK3)
   05225 Hepatocellular carcinoma
    118704886 (MAPK3)
   05226 Gastric cancer
    118704886 (MAPK3)
   05214 Glioma
    118704886 (MAPK3)
   05216 Thyroid cancer
    118704886 (MAPK3)
   05221 Acute myeloid leukemia
    118704886 (MAPK3)
   05220 Chronic myeloid leukemia
    118704886 (MAPK3)
   05218 Melanoma
    118704886 (MAPK3)
   05211 Renal cell carcinoma
    118704886 (MAPK3)
   05219 Bladder cancer
    118704886 (MAPK3)
   05215 Prostate cancer
    118704886 (MAPK3)
   05213 Endometrial cancer
    118704886 (MAPK3)
   05224 Breast cancer
    118704886 (MAPK3)
   05223 Non-small cell lung cancer
    118704886 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    118704886 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    118704886 (MAPK3)
   05161 Hepatitis B
    118704886 (MAPK3)
   05160 Hepatitis C
    118704886 (MAPK3)
   05171 Coronavirus disease - COVID-19
    118704886 (MAPK3)
   05164 Influenza A
    118704886 (MAPK3)
   05163 Human cytomegalovirus infection
    118704886 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    118704886 (MAPK3)
   05165 Human papillomavirus infection
    118704886 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    118704886 (MAPK3)
   05135 Yersinia infection
    118704886 (MAPK3)
   05133 Pertussis
    118704886 (MAPK3)
   05152 Tuberculosis
    118704886 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    118704886 (MAPK3)
   05140 Leishmaniasis
    118704886 (MAPK3)
   05142 Chagas disease
    118704886 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118704886 (MAPK3)
   05020 Prion disease
    118704886 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    118704886 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    118704886 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118704886 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    118704886 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    118704886 (MAPK3)
   04934 Cushing syndrome
    118704886 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118704886 (MAPK3)
   01524 Platinum drug resistance
    118704886 (MAPK3)
   01522 Endocrine resistance
    118704886 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pkl01001]
    118704886 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pkl03036]
    118704886 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pkl04147]
    118704886 (MAPK3)
Enzymes [BR:pkl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     118704886 (MAPK3)
Protein kinases [BR:pkl01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   118704886 (MAPK3)
Chromosome and associated proteins [BR:pkl03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     118704886 (MAPK3)
Exosome [BR:pkl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   118704886 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 118704886
NCBI-ProteinID: XP_036268846
LinkDB
Position
Unknown
AA seq 379 aa
MAAAAAPGGGGGEPRGAEGVGPGGAGDVEVVKGQPFDVGPRYSQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLDAMRDVYI
VQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSLEDLNCIINMKARNYLQSLPSKTKVGWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGVLEAT
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctccggggggcgggggcggggagccccggggagccgagggggtc
ggcccggggggcgcgggggacgtggaggtggtgaaggggcagccgttcgacgtgggcccg
cgctactcgcagctgcagtacatcggcgagggcgcctacggcatggtcagctcagcctat
gaccacgtccgcaagacacgtgtggccatcaagaaaatcagccccttcgagcaccagacc
tactgccagcgcacgctgcgggagatccagatcctgctgcgcttccgccacgagaatgtc
atcggcatccgggacatcctccgggcgcccacgctggatgccatgagggatgtctacatc
gtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctgagcaac
gaccacgtctgctacttcctctaccagatcctgcggggcctcaagtacatccactcggcc
aatgtgctgcaccgggacttaaagccctccaacctgctcatcaacaccacctgcgacctt
aagatctgcgattttggcctggcccggatcgcggaccctgagcatgaccacaccggcttc
ctgacagaatacgtggccacgcgctggtaccgggccccagagatcatgcttaactccaag
ggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgaaatgctctcc
aaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctgggcatc
ctgggctccccatccctcgaggacctgaactgcatcatcaacatgaaggcccggaactac
ctgcagtctctgccttccaagaccaaggtgggctgggccaagctgttccccaagtccgac
tccaaagcccttgacctgctggaccggatgttgacctttaaccccaacaaacggatcacc
gtggaagaagcgctggcgcacccctacttggagcagtactacgacccgacagacgagccg
gtggccgaggaacctttcacctttgacatggagctggatgacctgcccaaggagcggctg
aaggagctcatattccaggagacagcccgcttccagcctggcgtgctggaggccacctaa

DBGET integrated database retrieval system