Pipistrellus kuhlii (Kuhl's pipistrelle): 118708741
Help
Entry
118708741 CDS
T07682
Symbol
ATP5F1E
Name
(RefSeq) ATP synthase subunit epsilon, mitochondrial
KO
K02135
F-type H+-transporting ATPase subunit epsilon
Organism
pkl
Pipistrellus kuhlii (Kuhl's pipistrelle)
Pathway
pkl00190
Oxidative phosphorylation
pkl01100
Metabolic pathways
pkl04714
Thermogenesis
pkl05010
Alzheimer disease
pkl05012
Parkinson disease
pkl05014
Amyotrophic lateral sclerosis
pkl05016
Huntington disease
pkl05020
Prion disease
pkl05022
Pathways of neurodegeneration - multiple diseases
pkl05208
Chemical carcinogenesis - reactive oxygen species
pkl05415
Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:
pkl00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
118708741 (ATP5F1E)
09150 Organismal Systems
09159 Environmental adaptation
04714 Thermogenesis
118708741 (ATP5F1E)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
118708741 (ATP5F1E)
09164 Neurodegenerative disease
05010 Alzheimer disease
118708741 (ATP5F1E)
05012 Parkinson disease
118708741 (ATP5F1E)
05014 Amyotrophic lateral sclerosis
118708741 (ATP5F1E)
05016 Huntington disease
118708741 (ATP5F1E)
05020 Prion disease
118708741 (ATP5F1E)
05022 Pathways of neurodegeneration - multiple diseases
118708741 (ATP5F1E)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
118708741 (ATP5F1E)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
ATP-synt_Eps
Kazal_3
Motif
Other DBs
NCBI-GeneID:
118708741
NCBI-ProteinID:
XP_036276079
LinkDB
All DBs
Position
Unknown
AA seq
51 aa
AA seq
DB search
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKAGAEKSSGSSVKIVKVKKE
NT seq
156 nt
NT seq
+upstream
nt +downstream
nt
atggtggcctactggcgacaggctggactcagctacatccgctactcccagatctgtgca
aaagcggtgagagatgcactgaaaactgaattcaaagcaggtgccgagaagtcttctggc
agcagtgtcaaaattgtgaaagtgaagaaggaataa
DBGET
integrated database retrieval system