KEGG   Pipistrellus kuhlii (Kuhl's pipistrelle): 118718374
Entry
118718374         CDS       T07682                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
pkl  Pipistrellus kuhlii (Kuhl's pipistrelle)
Pathway
pkl04014  Ras signaling pathway
pkl04015  Rap1 signaling pathway
pkl04020  Calcium signaling pathway
pkl04022  cGMP-PKG signaling pathway
pkl04024  cAMP signaling pathway
pkl04070  Phosphatidylinositol signaling system
pkl04114  Oocyte meiosis
pkl04218  Cellular senescence
pkl04261  Adrenergic signaling in cardiomyocytes
pkl04270  Vascular smooth muscle contraction
pkl04371  Apelin signaling pathway
pkl04625  C-type lectin receptor signaling pathway
pkl04713  Circadian entrainment
pkl04720  Long-term potentiation
pkl04722  Neurotrophin signaling pathway
pkl04728  Dopaminergic synapse
pkl04740  Olfactory transduction
pkl04744  Phototransduction
pkl04750  Inflammatory mediator regulation of TRP channels
pkl04910  Insulin signaling pathway
pkl04912  GnRH signaling pathway
pkl04915  Estrogen signaling pathway
pkl04916  Melanogenesis
pkl04921  Oxytocin signaling pathway
pkl04922  Glucagon signaling pathway
pkl04924  Renin secretion
pkl04925  Aldosterone synthesis and secretion
pkl04970  Salivary secretion
pkl04971  Gastric acid secretion
pkl05010  Alzheimer disease
pkl05012  Parkinson disease
pkl05022  Pathways of neurodegeneration - multiple diseases
pkl05031  Amphetamine addiction
pkl05034  Alcoholism
pkl05133  Pertussis
pkl05152  Tuberculosis
pkl05163  Human cytomegalovirus infection
pkl05167  Kaposi sarcoma-associated herpesvirus infection
pkl05170  Human immunodeficiency virus 1 infection
pkl05200  Pathways in cancer
pkl05214  Glioma
pkl05417  Lipid and atherosclerosis
pkl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pkl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    118718374
   04015 Rap1 signaling pathway
    118718374
   04371 Apelin signaling pathway
    118718374
   04020 Calcium signaling pathway
    118718374
   04070 Phosphatidylinositol signaling system
    118718374
   04024 cAMP signaling pathway
    118718374
   04022 cGMP-PKG signaling pathway
    118718374
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    118718374
   04218 Cellular senescence
    118718374
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    118718374
  09152 Endocrine system
   04910 Insulin signaling pathway
    118718374
   04922 Glucagon signaling pathway
    118718374
   04912 GnRH signaling pathway
    118718374
   04915 Estrogen signaling pathway
    118718374
   04921 Oxytocin signaling pathway
    118718374
   04916 Melanogenesis
    118718374
   04924 Renin secretion
    118718374
   04925 Aldosterone synthesis and secretion
    118718374
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    118718374
   04270 Vascular smooth muscle contraction
    118718374
  09154 Digestive system
   04970 Salivary secretion
    118718374
   04971 Gastric acid secretion
    118718374
  09156 Nervous system
   04728 Dopaminergic synapse
    118718374
   04720 Long-term potentiation
    118718374
   04722 Neurotrophin signaling pathway
    118718374
  09157 Sensory system
   04744 Phototransduction
    118718374
   04740 Olfactory transduction
    118718374
   04750 Inflammatory mediator regulation of TRP channels
    118718374
  09159 Environmental adaptation
   04713 Circadian entrainment
    118718374
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118718374
  09162 Cancer: specific types
   05214 Glioma
    118718374
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    118718374
   05163 Human cytomegalovirus infection
    118718374
   05167 Kaposi sarcoma-associated herpesvirus infection
    118718374
  09171 Infectious disease: bacterial
   05133 Pertussis
    118718374
   05152 Tuberculosis
    118718374
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118718374
   05012 Parkinson disease
    118718374
   05022 Pathways of neurodegeneration - multiple diseases
    118718374
  09165 Substance dependence
   05031 Amphetamine addiction
    118718374
   05034 Alcoholism
    118718374
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118718374
   05418 Fluid shear stress and atherosclerosis
    118718374
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pkl01009]
    118718374
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pkl04131]
    118718374
   03036 Chromosome and associated proteins [BR:pkl03036]
    118718374
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pkl04147]
    118718374
Protein phosphatases and associated proteins [BR:pkl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     118718374
Membrane trafficking [BR:pkl04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    118718374
Chromosome and associated proteins [BR:pkl03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     118718374
Exosome [BR:pkl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   118718374
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C EF-hand_11 SPARC_Ca_bdg UPF0154 EFhand_Ca_insen FCaBP_EF-hand Dockerin_1 DUF1103 DUF5580_M SPEF2_C SurA_N_3 MecA_N Poly_export PA_Ig-like
Other DBs
NCBI-GeneID: 118718374
NCBI-ProteinID: XP_036293054
LinkDB
Position
Unknown
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGNETITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgaccaactgactgaagaacagattgctgaattcaaggaagctttctccctattt
gacaaagatggcaatgagaccatcaccacaaaggaacttggcaccgtcatgaggtcgctg
ggtcagaacccaacagaagctgaattgcaggatatgatcaatgaagtggatgctgatggc
aatggcaccattgacttcccagagtttttgaccatgatggccagaaaaatgaaagacaca
gacagcgaagaagaaatccgcgaggcattccgagtctttgacaaggatggcaacgggtac
atcagtgcggcagagctacgtcacgtcatgacaaacttaggagaaaaactaacagacgaa
gaagtagatgaaatgatcagagaagcagatatcgatggagacggacaagtcaactatgaa
gaattcgtacagatgatgactgcaaaatga

DBGET integrated database retrieval system