KEGG   Pipistrellus kuhlii (Kuhl's pipistrelle): 118727253
Entry
118727253         CDS       T07682                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
pkl  Pipistrellus kuhlii (Kuhl's pipistrelle)
Pathway
pkl01521  EGFR tyrosine kinase inhibitor resistance
pkl01522  Endocrine resistance
pkl04010  MAPK signaling pathway
pkl04012  ErbB signaling pathway
pkl04014  Ras signaling pathway
pkl04015  Rap1 signaling pathway
pkl04062  Chemokine signaling pathway
pkl04068  FoxO signaling pathway
pkl04071  Sphingolipid signaling pathway
pkl04072  Phospholipase D signaling pathway
pkl04137  Mitophagy - animal
pkl04140  Autophagy - animal
pkl04150  mTOR signaling pathway
pkl04151  PI3K-Akt signaling pathway
pkl04210  Apoptosis
pkl04211  Longevity regulating pathway
pkl04213  Longevity regulating pathway - multiple species
pkl04218  Cellular senescence
pkl04360  Axon guidance
pkl04370  VEGF signaling pathway
pkl04371  Apelin signaling pathway
pkl04540  Gap junction
pkl04550  Signaling pathways regulating pluripotency of stem cells
pkl04625  C-type lectin receptor signaling pathway
pkl04650  Natural killer cell mediated cytotoxicity
pkl04660  T cell receptor signaling pathway
pkl04662  B cell receptor signaling pathway
pkl04664  Fc epsilon RI signaling pathway
pkl04714  Thermogenesis
pkl04720  Long-term potentiation
pkl04722  Neurotrophin signaling pathway
pkl04725  Cholinergic synapse
pkl04726  Serotonergic synapse
pkl04730  Long-term depression
pkl04810  Regulation of actin cytoskeleton
pkl04910  Insulin signaling pathway
pkl04912  GnRH signaling pathway
pkl04915  Estrogen signaling pathway
pkl04916  Melanogenesis
pkl04917  Prolactin signaling pathway
pkl04919  Thyroid hormone signaling pathway
pkl04921  Oxytocin signaling pathway
pkl04926  Relaxin signaling pathway
pkl04929  GnRH secretion
pkl04933  AGE-RAGE signaling pathway in diabetic complications
pkl04935  Growth hormone synthesis, secretion and action
pkl05010  Alzheimer disease
pkl05022  Pathways of neurodegeneration - multiple diseases
pkl05034  Alcoholism
pkl05160  Hepatitis C
pkl05161  Hepatitis B
pkl05163  Human cytomegalovirus infection
pkl05165  Human papillomavirus infection
pkl05166  Human T-cell leukemia virus 1 infection
pkl05167  Kaposi sarcoma-associated herpesvirus infection
pkl05170  Human immunodeficiency virus 1 infection
pkl05200  Pathways in cancer
pkl05203  Viral carcinogenesis
pkl05205  Proteoglycans in cancer
pkl05206  MicroRNAs in cancer
pkl05207  Chemical carcinogenesis - receptor activation
pkl05208  Chemical carcinogenesis - reactive oxygen species
pkl05210  Colorectal cancer
pkl05211  Renal cell carcinoma
pkl05213  Endometrial cancer
pkl05214  Glioma
pkl05215  Prostate cancer
pkl05216  Thyroid cancer
pkl05218  Melanoma
pkl05219  Bladder cancer
pkl05220  Chronic myeloid leukemia
pkl05221  Acute myeloid leukemia
pkl05223  Non-small cell lung cancer
pkl05224  Breast cancer
pkl05225  Hepatocellular carcinoma
pkl05226  Gastric cancer
pkl05230  Central carbon metabolism in cancer
pkl05231  Choline metabolism in cancer
pkl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pkl05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pkl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    118727253 (NRAS)
   04015 Rap1 signaling pathway
    118727253 (NRAS)
   04068 FoxO signaling pathway
    118727253 (NRAS)
   04072 Phospholipase D signaling pathway
    118727253 (NRAS)
   04071 Sphingolipid signaling pathway
    118727253 (NRAS)
   04151 PI3K-Akt signaling pathway
    118727253 (NRAS)
   04150 mTOR signaling pathway
    118727253 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    118727253 (NRAS)
   04137 Mitophagy - animal
    118727253 (NRAS)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    118727253 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    118727253 (NRAS)
   04660 T cell receptor signaling pathway
    118727253 (NRAS)
   04662 B cell receptor signaling pathway
    118727253 (NRAS)
   04664 Fc epsilon RI signaling pathway
    118727253 (NRAS)
   04062 Chemokine signaling pathway
    118727253 (NRAS)
  09152 Endocrine system
   04929 GnRH secretion
    118727253 (NRAS)
   04915 Estrogen signaling pathway
    118727253 (NRAS)
   04917 Prolactin signaling pathway
    118727253 (NRAS)
   04921 Oxytocin signaling pathway
    118727253 (NRAS)
   04926 Relaxin signaling pathway
    118727253 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    118727253 (NRAS)
   04919 Thyroid hormone signaling pathway
    118727253 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    118727253 (NRAS)
   04726 Serotonergic synapse
    118727253 (NRAS)
   04720 Long-term potentiation
    118727253 (NRAS)
   04730 Long-term depression
    118727253 (NRAS)
   04722 Neurotrophin signaling pathway
    118727253 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    118727253 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    118727253 (NRAS)
   04213 Longevity regulating pathway - multiple species
    118727253 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    118727253 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118727253 (NRAS)
   05206 MicroRNAs in cancer
    118727253 (NRAS)
   05205 Proteoglycans in cancer
    118727253 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    118727253 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    118727253 (NRAS)
   05203 Viral carcinogenesis
    118727253 (NRAS)
   05230 Central carbon metabolism in cancer
    118727253 (NRAS)
   05231 Choline metabolism in cancer
    118727253 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    118727253 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    118727253 (NRAS)
   05225 Hepatocellular carcinoma
    118727253 (NRAS)
   05226 Gastric cancer
    118727253 (NRAS)
   05214 Glioma
    118727253 (NRAS)
   05216 Thyroid cancer
    118727253 (NRAS)
   05221 Acute myeloid leukemia
    118727253 (NRAS)
   05220 Chronic myeloid leukemia
    118727253 (NRAS)
   05218 Melanoma
    118727253 (NRAS)
   05211 Renal cell carcinoma
    118727253 (NRAS)
   05219 Bladder cancer
    118727253 (NRAS)
   05215 Prostate cancer
    118727253 (NRAS)
   05213 Endometrial cancer
    118727253 (NRAS)
   05224 Breast cancer
    118727253 (NRAS)
   05223 Non-small cell lung cancer
    118727253 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    118727253 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    118727253 (NRAS)
   05161 Hepatitis B
    118727253 (NRAS)
   05160 Hepatitis C
    118727253 (NRAS)
   05163 Human cytomegalovirus infection
    118727253 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    118727253 (NRAS)
   05165 Human papillomavirus infection
    118727253 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118727253 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    118727253 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    118727253 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118727253 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    118727253 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118727253 (NRAS)
   01522 Endocrine resistance
    118727253 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pkl04131]
    118727253 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pkl04147]
    118727253 (NRAS)
   04031 GTP-binding proteins [BR:pkl04031]
    118727253 (NRAS)
Membrane trafficking [BR:pkl04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    118727253 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    118727253 (NRAS)
Exosome [BR:pkl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   118727253 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   118727253 (NRAS)
  Exosomal proteins of breast cancer cells
   118727253 (NRAS)
  Exosomal proteins of colorectal cancer cells
   118727253 (NRAS)
GTP-binding proteins [BR:pkl04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    118727253 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 118727253
NCBI-ProteinID: XP_036308771
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCAVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaaactggtggtggtcggagcaggcggagtggggaagagcgcgctgacc
atccagctcatccagaaccactttgtggacgaatatgatcccaccatcgaggattcttac
cgaaagcaggtggtgattgacggtgagacctgcctgctggacatcctggacacggctggg
caagaggagtacagcgccatgcgggaccagtacatgaggaccggggagggcttcctctgt
gtgttcgccatcaacaacagcaagtcgtttgcagacattaacctctacagggaacagatt
aagcgagtgaaggactccgatgatgttccaatggtgctcgtgggaaacaagtgtgactta
ccaacaaggacggtggacacaaaacaagcccatgaactggccaagagttacgggattcca
ttcatcgagacctcagccaagaccagacagggtgttgaagatgccttttacacactggtg
agagaaatccgtcagtaccggatgaaaaaactcaacagcagcgatgacgggacccaaggc
tgcatggggctgccctgtgcggtgatgtaa

DBGET integrated database retrieval system