Pempheris klunzingeri: 139205866 Help Entry 139205866         CDS       T11454                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism pklu  Pempheris klunzingeri Pathway pklu04010   MAPK signaling pathway pklu04144   Endocytosis pklu04370   VEGF signaling pathway pklu04510   Focal adhesion pklu04517   IgSF CAM signaling pklu04518   Integrin signaling pklu04520   Adherens junction pklu04530   Tight junction pklu04810   Regulation of actin cytoskeleton pklu04912   GnRH signaling pathway pklu05100   Bacterial invasion of epithelial cells pklu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pklu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     139205866 (cdc42l)    04370 VEGF signaling pathway     139205866 (cdc42l)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     139205866 (cdc42l)    04518 Integrin signaling     139205866 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     139205866 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     139205866 (cdc42l)    04520 Adherens junction     139205866 (cdc42l)    04530 Tight junction     139205866 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     139205866 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     139205866 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     139205866 (cdc42l)    05100 Bacterial invasion of epithelial cells     139205866 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pklu04131]     139205866 (cdc42l)    03036 Chromosome and associated proteins [BR:pklu03036]     139205866 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pklu04147]     139205866 (cdc42l)    04031 GTP-binding proteins [BR:pklu04031]     139205866 (cdc42l) Membrane trafficking [BR:pklu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     139205866 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     139205866 (cdc42l)   Macropinocytosis    Ras GTPases     139205866 (cdc42l) Chromosome and associated proteins [BR:pklu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     139205866 (cdc42l) Exosome [BR:pklu04147]  Exosomal proteins   Exosomal proteins of microglial cells    139205866 (cdc42l)   Exosomal proteins of breast milk    139205866 (cdc42l) GTP-binding proteins [BR:pklu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     139205866 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  139205866 NCBI-ProteinID:  XP_070692306 LinkDB All DBs Position 8:complement(18054817..18059129) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR EDSNTTEKLAKNKQRPLYPDSGEKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTKRKCLLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgtgtagtggtaggggacggtgcagtaggaaagacctgcttactg atctcctacacaaccaacaagttcccctcagaatatgtgcctacggtttttgacaattat gcagtgacggtgatgattggaggagagccctatacacttggcctatttgacacagcaggt caggaggattacgacaggctgcgtcctctcagctatccacagacagatgtgtttcttgta tgtttctcagtcgtctccccctcatcatttgaaaacgtcaaagagaagtgggttcctgag atttctcaccattgcccgcgcacgcccttcctgttagtgggcacacaggtggacctgcgg gaagacagcaacacgactgagaagctggcaaaaaacaaacagcgtcccttatatcccgac agcggagagaagctggcccgggagctcagggctgtcaaatatgtggagtgctctgctctc acacagcgagggcttaagaatgtgtttgacgaggccatcctggcagccttggagcctcct gagaccaaaaccaagagaaagtgccttctgctatag

DBGET integrated database retrieval system