Pempheris klunzingeri: 139208636 Help Entry 139208636         CDS       T11454                                  Symbol myl6 Name (RefSeq) myosin light polypeptide 6   KO K12751   myosin light chain 6 Organism pklu  Pempheris klunzingeri Pathway pklu04270   Vascular smooth muscle contraction pklu04517   IgSF CAM signaling pklu04530   Tight junction pklu04814   Motor proteins Brite KEGG Orthology (KO) [BR:pklu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     139208636 (myl6)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     139208636 (myl6)   09142 Cell motility    04814 Motor proteins     139208636 (myl6)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     139208636 (myl6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pklu04812]     139208636 (myl6)    04147 Exosome [BR:pklu04147]     139208636 (myl6) Cytoskeleton proteins [BR:pklu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      139208636 (myl6) Exosome [BR:pklu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    139208636 (myl6)   Exosomal proteins of bladder cancer cells    139208636 (myl6) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_6 EF-hand_1 EF-hand_7 CFAP251_C EF_EFCAB10_C AIF-1 EF-hand_8 Motif Other DBs NCBI-GeneID:  139208636 NCBI-ProteinID:  XP_070694464 LinkDB All DBs Position 2:complement(10247466..10252293) Genome browser AA seq 151 aa AA seqDB search MSDFTEDQIMEFKEAFLLFDRTGEGKITYSQCGDVMRALGQNPVNAEVLKVLGNPKLEEM NHKMLDFEQFLPMLQAIAKNKDQGSFEDIVEGLRVFDKEGNGTVMGAELRHVLTTLGEKM TEEEVETLLAGHEDANGCINYEELVRMVMSG NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtctgacttcacagaggaccagatcatggagttcaaggaggccttccttctgtttgac cggacgggggaggggaagatcacctacagccagtgtggtgatgtcatgcgggccctcgga cagaaccccgtcaacgcagaggtgctcaaggtcctgggaaaccccaagttggaagagatg aaccacaagatgctggattttgagcagttcctgccgatgcttcaggccattgctaagaac aaggaccagggctcctttgaggacatcgtagagggtctgcgtgtcttcgacaaggaggga aacggcacagtgatgggagcagagctacgtcatgtcctcactacgctgggtgaaaaaatg accgaggaggaggtggagactcttttagcgggacatgaagacgccaatggctgcattaac tatgaagaactcgtgcggatggtgatgagcggctga

DBGET integrated database retrieval system