Pempheris klunzingeri: 139219563 Help Entry 139219563         CDS       T11454                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism pklu  Pempheris klunzingeri Pathway pklu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pklu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     139219563  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pklu04121]     139219563    03400 DNA repair and recombination proteins [BR:pklu03400]     139219563 Ubiquitin system [BR:pklu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      139219563    Cul5 complex      139219563 DNA repair and recombination proteins [BR:pklu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      139219563 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  139219563 NCBI-ProteinID:  XP_070707573 LinkDB All DBs Position 20:11620912..11624608 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRTPEDQRLYKDDQLLEDSKTLGDC GFTNQTARPQAPATVGLAFRINDEMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcttaatgatccggcgtcacaagaccacaatcttcacagatgccaaggag tccaccactgtctatgagctgaagcgcattgttgaaggaatactaaagagaacacctgaa gaccagaggctctataaagatgaccagttgctagaggacagcaaaactcttggtgactgt ggattcaccaaccagactgccagacctcaagccccagctacagttggtctggccttccgc ataaatgatgagatgttcgaacagctgcacatcgaggccttctccagccccccagaactc cccgatgtgatgaagccgcaggactctggtagcaccgctaacgaacaggctgtgcagtga

DBGET integrated database retrieval system