Pseudomonas kermanshahensis: PZ739_17435 Help Entry PZ739_17435       CDS       T08964                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism pkm  Pseudomonas kermanshahensis Pathway pkm00260   Glycine, serine and threonine metabolism pkm01100   Metabolic pathways Module pkm_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:pkm00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     PZ739_17435 Enzymes [BR:pkm01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      PZ739_17435     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      PZ739_17435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  WEL53618 LinkDB All DBs Position 3919495..3919800 Genome browser AA seq 101 aa AA seqDB search MKILTCPLNGPRNISEFTYGGEFKHMPDPAACSDAEWADYVFNSDNHAGVVIEWWLHNAS SYWFLAERHTVSDQVLRTFDPKALFDRRVDFTPAATPEIAG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaagatcctgacctgccccttgaacggcccgcgcaacatcagcgaattcacctacggc ggcgagttcaagcacatgcccgacccggccgcgtgcagcgatgccgaatgggccgactac gtgttcaacagcgacaaccacgccggtgtggtcatcgagtggtggctgcacaacgcctcc agctactggttcctggccgagcgccacaccgtcagcgaccaggtgctgcgcaccttcgac ccgaaagcactgttcgaccgccgcgtcgacttcacccccgccgccacaccggagatcgcc ggatga

DBGET integrated database retrieval system