Pseudomonas kermanshahensis: PZ739_26790 Help Entry PZ739_26790       CDS       T08964                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pkm  Pseudomonas kermanshahensis Brite KEGG Orthology (KO) [BR:pkm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pkm03036]     PZ739_26790 Chromosome and associated proteins [BR:pkm03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PZ739_26790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB Motif Other DBs NCBI-ProteinID:  WEL58333 LinkDB All DBs Position 5985786..5985968 Genome browser AA seq 60 aa AA seqDB search MSRFELLIERVEQLKRQNALLVAQEKSWREERAHLIEKNEIARRKVESMILRLKALEQDS NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgagccgattcgagttgctgatcgaacgtgtcgagcaactaaaacggcaaaatgcactc ctagtagctcaggaaaaatcctggcgcgaagagcgcgcccacctcatcgaaaagaacgag atcgcaaggcgcaaggtcgagtcgatgattttacgcctcaaggctctggagcaagactca tga

DBGET integrated database retrieval system