Plasmodium knowlesi: 7323107 Help Entry 7323107           CDS       T01094                                  Name (RefSeq) dynein light chain 1, putative   KO K10418   dynein light chain LC8-type Organism pkn  Plasmodium knowlesi Pathway pkn04145   Phagocytosis pkn04517   IgSF CAM signaling pkn04814   Motor proteins Brite KEGG Orthology (KO) [BR:pkn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     7323107  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     7323107   09142 Cell motility    04814 Motor proteins     7323107  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pkn03037]     7323107    04812 Cytoskeleton proteins [BR:pkn04812]     7323107 Cilium and associated proteins [BR:pkn03037]  Motile cilia and associated proteins   Dynein arm    7323107 Cytoskeleton proteins [BR:pkn04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      7323107 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light CotJB Motif Other DBs NCBI-GeneID:  7323107 NCBI-ProteinID:  XP_002262213 UniProt:  A0A384K9L0 LinkDB All DBs Position 14:<1465631..>1465912 Genome browser AA seq 93 aa AA seqDB search MADRKSNKNAVVKNVDMTEEMQIDAIDCANQALQKYNVEKDIAAHIKKEFDRKYDPTWHC VVGRNFGSYVTHETKNFIYFYIGQVAILLFKSG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcggatagaaaatcaaacaaaaatgccgttgtcaagaatgtagatatgacggaagaa atgcaaattgatgctatcgattgtgccaatcaggccttacaaaaatataatgtcgaaaag gatattgcagcccatataaaaaaagaatttgacagaaaatatgacccaacatggcattgc gtagtgggcagaaacttcgggtcatatgttacacacgaaactaagaattttatttatttt tacattggacaagtagctatactgctgtttaagtcgggctaa

DBGET integrated database retrieval system