Plasmodium knowlesi: PKNH_1433100 Help Entry PKNH_1433100      CDS       T01094                                  Name (RefSeq) dynein light chain 1, putative   KO K10418   dynein light chain LC8-type Organism pkn  Plasmodium knowlesi Pathway pkn04517   IgSF CAM signaling pkn04814   Motor proteins Brite KEGG Orthology (KO) [BR:pkn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     PKNH_1433100  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     PKNH_1433100  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pkn03037]     PKNH_1433100    04812 Cytoskeleton proteins [BR:pkn04812]     PKNH_1433100 Cilium and associated proteins [BR:pkn03037]  Motile cilia and associated proteins   Dynein arm    PKNH_1433100 Cytoskeleton proteins [BR:pkn04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PKNH_1433100 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light CotJB Motif Other DBs NCBI-GeneID:  7323107 NCBI-ProteinID:  XP_002262213 UniProt:  A0A5K1U2K5 A0A384K9L0 LinkDB All DBs Position 14:<1465631..>1465912 Genome browser AA seq 93 aa AA seqDB search MADRKSNKNAVVKNVDMTEEMQIDAIDCANQALQKYNVEKDIAAHIKKEFDRKYDPTWHC VVGRNFGSYVTHETKNFIYFYIGQVAILLFKSG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcggatagaaaatcaaacaaaaatgccgttgtcaagaatgtagatatgacggaagaa atgcaaattgatgctatcgattgtgccaatcaggccttacaaaaatataatgtcgaaaag gatattgcagcccatataaaaaaagaatttgacagaaaatatgacccaacatggcattgc gtagtgggcagaaacttcgggtcatatgttacacacgaaactaagaattttatttatttt tacattggacaagtagctatactgctgtttaagtcgggctaa

DBGET integrated database retrieval system