Pontibacter korlensis: PKOR_05135 Help Entry PKOR_05135        CDS       T03841                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pko  Pontibacter korlensis Pathway pko01100   Metabolic pathways pko01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pko00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PKOR_05135    00074 Mycolic acid biosynthesis     PKOR_05135   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PKOR_05135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AKD02619 UniProt:  A0A0E3ZDU4 LinkDB All DBs Position complement(1234863..1235114) Genome browser AA seq 83 aa AA seqDB search MIATNTAIEREVIRIISKTKEIKADRLWADRMLQDFGFDIVDVVDIILELEKSFKITIPD EVKIDTVGDFVNYVATHTISRGN NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgattgctactaataccgctattgagagggaggttatccgcatcattagcaaaaccaaa gagataaaagctgatcgcctgtgggcagacagaatgttgcaggacttcgggttcgacatc gtagacgtggttgatattatcctcgaattggagaagagctttaaaatcactatcccggac gaggtaaagattgataccgtgggcgactttgtaaactacgttgctacccacacgattagc aggggaaattaa

DBGET integrated database retrieval system