Pseudomonas koreensis: AYO71_01370 Help Entry AYO71_01370       CDS       T04647                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pkr  Pseudomonas koreensis Brite KEGG Orthology (KO) [BR:pkr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pkr03036]     AYO71_01370 Chromosome and associated proteins [BR:pkr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AYO71_01370 SSDB OrthologParalogGFIT Motif Pfam:  Asd-4 ZapB_rel Filament ZapB KIF21A_2nd Motif Other DBs NCBI-ProteinID:  AMT86238 UniProt:  A0A142N3H6 LinkDB All DBs Position complement(304247..304456) Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMARLELLIGRVEQLKSQNALLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatggccagactcgaactgctgattggccgagtc gagcaacttaagagtcaaaacgcactcttactagctcaggaaaaaacctggcgcgaggaa cgcgctcacctcattgaaaaaaacgaaatcgcccggcgtaaggtcgaatcgatgatttcg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system