Pseudomonas koreensis: AYO71_04940 Help Entry AYO71_04940       CDS       T04647                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pkr  Pseudomonas koreensis Pathway pkr00998   Biosynthesis of various antibiotics pkr01100   Metabolic pathways pkr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pkr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AYO71_04940    00074 Mycolic acid biosynthesis     AYO71_04940   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AYO71_04940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AMT86910 UniProt:  A0A142N6S0 LinkDB All DBs Position complement(1108337..1108612) Genome browser AA seq 91 aa AA seqDB search MSELNTASLVRDIKLLIIDALGLEDISPEDIGDEQTLFGEGLGLDSVDALELGLAIQKKY GIKIDADAKDTRNHFTNVASLAAFVTAKQAA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagcgaactgaacaccgctagcctggtgcgtgacatcaaactgctgatcatcgatgcc ttgggcctggaagacatcagccccgaggacatcggcgacgagcagacattgttcggcgaa ggcctcggcctggactccgtggacgcgctggaactgggcctggcgatccagaaaaaatac ggcatcaagatcgacgccgatgccaaagacacccgcaaccatttcaccaacgtggccagc cttgcggcattcgtcacggcaaaacaggcagcttga

DBGET integrated database retrieval system