Pseudomonas koreensis: AYO71_08350 Help Entry AYO71_08350       CDS       T04647                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pkr  Pseudomonas koreensis Brite KEGG Orthology (KO) [BR:pkr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pkr03036]     AYO71_08350 Chromosome and associated proteins [BR:pkr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AYO71_08350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ZapB NRBF2 Csm1_N YabA Motif Other DBs NCBI-ProteinID:  AMT87554 UniProt:  A0A142N5G2 LinkDB All DBs Position 1928608..1928886 Genome browser AA seq 92 aa AA seqDB search MRSPYWLFLVLLLLLAGLQYRLWVGNGSLAQVAELKQQIAEQHAENEGLLERNRVMDAEV SELKKGMETVEERARHELGMVKDGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtccttactggttgtttcttgttttgctcttgctgctggccggtctgcagtac cgcctgtgggtgggcaatggcagtctggcgcaggtcgccgagctgaaacagcagatcgcc gagcaacatgccgagaacgaaggcctgctggagcgcaaccgggtgatggacgctgaagtc agcgagctgaagaaaggcatggagaccgttgaagagcgtgctcgtcacgaactgggcatg gtcaaggacggcgaaaccctttaccagttggcccaatga

DBGET integrated database retrieval system