Paucibacter sp. KCTC 42545: AT984_06605 Help Entry AT984_06605       CDS       T04227                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism pkt  Paucibacter sp. KCTC 42545 Brite KEGG Orthology (KO) [BR:pkt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pkt03032]     AT984_06605    03036 Chromosome and associated proteins [BR:pkt03036]     AT984_06605    03400 DNA repair and recombination proteins [BR:pkt03400]     AT984_06605 DNA replication proteins [BR:pkt03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AT984_06605 Chromosome and associated proteins [BR:pkt03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AT984_06605 DNA repair and recombination proteins [BR:pkt03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AT984_06605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 UBA_HYPK HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  ALT76908 UniProt:  A0A0U3D9W9 LinkDB All DBs Position 1489101..1489373 Genome browser AA seq 90 aa AA seqDB search MNKSELIDHIATQADISKAAAARALEAVIVGVKTTLKKNGTVSLVGFGTFSVTKRAARAG RNPRTGDAIKIKSAKVPKFRPGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataagtctgaactgatcgatcacattgccacgcaagcggatatttccaaggctgcg gcggcgcgggctttggaagcagtgatagtcggtgtcaagaccacgttgaagaagaacggc acggtgtcgctggtgggtttcggtacgttcagcgtcaccaagcgcgctgcgcgtgcgggc cgcaacccacgcacgggggatgccatcaaaatcaagtccgccaaggtgccaaaattccgt cctggcaaggctttgaaagatgcggtcaattaa

DBGET integrated database retrieval system