Psychrobacter sp. KH172YL61: PKHYL_05930
Help
Entry
PKHYL_05930 CDS
T08351
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
pky
Psychrobacter sp. KH172YL61
Pathway
pky00770
Pantothenate and CoA biosynthesis
pky01100
Metabolic pathways
pky01240
Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:
pky00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
PKHYL_05930 (coaD)
Enzymes [BR:
pky01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
PKHYL_05930 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Motif
Other DBs
NCBI-ProteinID:
BBI66402
LinkDB
All DBs
Position
489428..489859
Genome browser
AA seq
143 aa
AA seq
DB search
MDLVTRATKLFDEVVIAVASGHHKKPLFNFEERVALVETVFADLPQVSVIGFEGLLVDFM
REKHATAVLRGLRAMSDFEYEFQLANMNRELDENFEAVFLTPSQNYSFISSTMIREIAKL
GGDVSKFVPPGVLQAFDKKLNSN
NT seq
432 nt
NT seq
+upstream
nt +downstream
nt
gtggatttggtgacacgcgcaaccaagctctttgatgaggttgtgattgcggttgcctcg
gggcatcataaaaaacctctatttaattttgaagagcgcgttgctttagtcgaaaccgta
tttgccgatttgccgcaagtctcggtgattggctttgaagggttgctcgttgattttatg
cgcgaaaaacacgccaccgccgtgctgcgcgggctgcgagcgatgtccgattttgagtac
gagtttcaactggccaatatgaaccgcgagcttgatgaaaactttgaagccgtatttttg
accccctctcagaactattcattcatctcatcgaccatgattcgtgaaattgccaaactc
ggtggcgatgtcagtaaatttgtcccacctggtgtgttgcaagcttttgacaaaaagtta
aatagtaactaa
DBGET
integrated database retrieval system