Psychrobacter sp. KH172YL61: PKHYL_07970 Help Entry PKHYL_07970       CDS       T08351                                  Symbol hvrA Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism pky  Psychrobacter sp. KH172YL61 Brite KEGG Orthology (KO) [BR:pky00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pky03036]     PKHYL_07970 (hvrA)    03400 DNA repair and recombination proteins [BR:pky03400]     PKHYL_07970 (hvrA) Chromosome and associated proteins [BR:pky03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     PKHYL_07970 (hvrA) DNA repair and recombination proteins [BR:pky03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       PKHYL_07970 (hvrA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS TSP_NTD Motif Other DBs NCBI-ProteinID:  BBI66606 UniProt:  A0A7U6QM91 LinkDB All DBs Position 655517..655840 Genome browser AA seq 107 aa AA seqDB search MSKNNAIDLDNLNVDELRAISENAQQLIAKKQHQRLYDAYIQFEQIAEDSNATIEEILKA GEKLEKKRSIKYRNTDNKEETWTGRGRKPTWLVEALAAGRGLEDFAI NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgagtaaaaataacgcaattgatttagataacttaaacgtagatgaactacgtgccatc agcgaaaatgcccagcagcttattgccaaaaaacagcatcagcgtttgtatgatgcttat attcagtttgagcaaattgcagaagacagcaacgctacgattgaagagatcttaaaagct ggtgaaaaactagagaaaaaacgcagtattaagtatcgcaatactgataacaaggaagaa acttggactggtcgtggacgtaaaccaacgtggttggttgaagcactagcagcaggtcgt ggccttgaagattttgctatctaa

DBGET integrated database retrieval system