Pichia kudriavzevii: C5L36_0A04230 Help Entry C5L36_0A04230     CDS       T06133                                  Name (RefSeq) uncharacterized protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism pkz  Pichia kudriavzevii Pathway pkz03060   Protein export pkz04141   Protein processing in endoplasmic reticulum pkz04145   Phagosome Brite KEGG Orthology (KO) [BR:pkz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     C5L36_0A04230    04141 Protein processing in endoplasmic reticulum     C5L36_0A04230  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     C5L36_0A04230  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pkz04131]     C5L36_0A04230   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pkz02044]     C5L36_0A04230 Membrane trafficking [BR:pkz04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     C5L36_0A04230 Secretion system [BR:pkz02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    C5L36_0A04230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  40381534 NCBI-ProteinID:  XP_029319301 LinkDB All DBs Position 1:944344..944544 Genome browser AA seq 66 aa AA seqDB search MADMEKMTDAPVEFLRDGARFLQKCTKPSQKEYMQLIRAVGMGFIMMGVVGYLIKLIHIP IRYLIV NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atggcagacatggaaaagatgacagacgctccagtggagttcctcagagacggcgcacgt ttcctccaaaaatgcacaaagccctctcagaaagagtacatgcaattgatcagagcagtc ggcatgggtttcatcatgatgggtgttgttggctacctcatcaagttgatccacattccg atcagatacttgattgtctag

DBGET integrated database retrieval system