Pichia kudriavzevii: C5L36_0A04870 Help Entry C5L36_0A04870     CDS       T06133                                  Name (RefSeq) uncharacterized protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism pkz  Pichia kudriavzevii Pathway pkz03020   RNA polymerase pkz03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pkz00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     C5L36_0A04870   09124 Replication and repair    03420 Nucleotide excision repair     C5L36_0A04870  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pkz03021]     C5L36_0A04870    03400 DNA repair and recombination proteins [BR:pkz03400]     C5L36_0A04870 Transcription machinery [BR:pkz03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      C5L36_0A04870   RNA polymerase III system    RNA polymerase III      C5L36_0A04870   RNA polymerase I system    RNA polymerase I      C5L36_0A04870 DNA repair and recombination proteins [BR:pkz03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       C5L36_0A04870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_N Motif Other DBs NCBI-GeneID:  40381600 NCBI-ProteinID:  XP_029319367 UniProt:  A0A2U9QXX9 LinkDB All DBs Position 1:1070962..1071198 Genome browser AA seq 78 aa AA seqDB search MIIPVRCFSCGKVVGDKWETYLSYLEDDHMSEGDALDRLKLKRYCCRRMVLTHVDLIEKF LKYNPLEKKEIVDEERAY NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgattattccagtcagatgtttttcctgtggtaaggtcgttggtgacaaatgggaaacc tacctctcatatctagaggatgaccacatgagtgagggtgacgcccttgacagactcaag ttgaagagatactgttgtagaagaatggtgttaacccatgttgacttgattgaaaagttc ttgaaatacaatccattggagaagaaggaaattgttgatgaagaacgtgcttactaa

DBGET integrated database retrieval system