Parvibaculum lavamentivorans: Plav_1489 Help Entry Plav_1489         CDS       T00580                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism pla  Parvibaculum lavamentivorans Pathway pla01100   Metabolic pathways pla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pla00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Plav_1489    00074 Mycolic acid biosynthesis     Plav_1489   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Plav_1489 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  ABS63109 UniProt:  A7HT76 LinkDB All DBs Position 1619586..1619837 Genome browser AA seq 83 aa AA seqDB search MNRDEIYEKLKGFLIELFEIPEERISLDAHLSDDLDLDSIDAVDLILKLQEFIGRKVSAE QFRSVRTVRDVIDQVHELLGQAA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaaccgggatgaaatttacgagaagctgaaagggtttctgatcgaactcttcgaaatc ccggaagagcggatttcgctcgatgcccacctgtcggatgatctcgatctcgacagcatc gatgcagtcgacctcattctcaaactccaggaatttatcggccgcaaggtttcagcggaa cagttccgctcggtgcggacggttcgcgatgtcatcgaccaggttcatgagcttctcggc caggcggcctga

DBGET integrated database retrieval system