Parvibaculum lavamentivorans: Plav_3124 Help Entry Plav_3124         CDS       T00580                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pla  Parvibaculum lavamentivorans Pathway pla02024   Quorum sensing pla03018   RNA degradation Brite KEGG Orthology (KO) [BR:pla00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Plav_3124  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Plav_3124  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pla03019]     Plav_3124    03036 Chromosome and associated proteins [BR:pla03036]     Plav_3124 Messenger RNA biogenesis [BR:pla03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Plav_3124 Chromosome and associated proteins [BR:pla03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Plav_3124 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 AcMNPV_AC11 Motif Other DBs NCBI-ProteinID:  ABS64731 UniProt:  A7HXU8 LinkDB All DBs Position complement(3335130..3335378) Genome browser AA seq 82 aa AA seqDB search MNEKTHNLQDTFLNHVRKNKTTLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHA ISTIMPAQPVQLFEPEANGEEG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaatgagaagacccataacctgcaggatacgttcctgaaccacgttcgcaagaacaag acgaccctcaccatctttctggtaaatggcgtcaagcttcagggcgtggtcacctggttc gacaacttttgtgtgttgctgcgccgggacggccattcgcagctcgtgtataagcacgcg atatcgaccattatgccggcccagcccgttcagcttttcgagcctgaagccaacggggag gagggctga

DBGET integrated database retrieval system