Paraburkholderia largidicola: PPGU16_11910 Help Entry PPGU16_11910      CDS       T10364                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism plad  Paraburkholderia largidicola Pathway plad02024   Quorum sensing plad03018   RNA degradation Brite KEGG Orthology (KO) [BR:plad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PPGU16_11910 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PPGU16_11910 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:plad03019]     PPGU16_11910 (hfq)    03036 Chromosome and associated proteins [BR:plad03036]     PPGU16_11910 (hfq) Messenger RNA biogenesis [BR:plad03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PPGU16_11910 (hfq) Chromosome and associated proteins [BR:plad03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PPGU16_11910 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  BCF88124 UniProt:  A0A7I8BHE4 LinkDB All DBs Position 1:1364897..1365133 Genome browser AA seq 78 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARPVNFHPDSESS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaattgttacaagacccgtttttgaacgcactgcgtaaagagcac gtgccggtctcgatctatctggtcaacggcatcaagcttcaagggaacattgaatcgttc gaccagtacgtcgtgttgctccggaatacggtaacccagatggtctacaagcacgctatc tcgactgtcgtgcctgcccgtccggtgaatttccacccggattccgaatcatcctaa

DBGET integrated database retrieval system