Plasmodium adleri: 39742849 Help Entry 39742849          CDS       T10353                                  Symbol PADL01_1214100 Name (RefSeq) dynein light chain 1, putative   KO K10418   dynein light chain LC8-type Organism plag  Plasmodium adleri Pathway plag04145   Phagocytosis plag04517   IgSF CAM signaling plag04814   Motor proteins Brite KEGG Orthology (KO) [BR:plag00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     39742849 (PADL01_1214100)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     39742849 (PADL01_1214100)   09142 Cell motility    04814 Motor proteins     39742849 (PADL01_1214100)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:plag03037]     39742849 (PADL01_1214100)    04812 Cytoskeleton proteins [BR:plag04812]     39742849 (PADL01_1214100) Cilium and associated proteins [BR:plag03037]  Motile cilia and associated proteins   Dynein arm    39742849 (PADL01_1214100) Cytoskeleton proteins [BR:plag04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      39742849 (PADL01_1214100) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light CotJB Motif Other DBs NCBI-GeneID:  39742849 NCBI-ProteinID:  XP_028539307 PlasmoDB:  PADL01_1214100 LinkDB All DBs Position 12:<584336..>584617 Genome browser AA seq 93 aa AA seqDB search MADRKSNKNAVVKNVDMTEEMQIDAIDCANQALQKYNVEKDIAAHIKKEFDRKYDPTWHC VVGRNFGSYVTHETKNFIYFYIGQVAILLFKSG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctgatagaaaatcaaataaaaatgcagttgtaaaaaatgtagatatgacagaagaa atgcaaattgatgctattgattgtgctaatcaggccttacaaaaatataacgtcgaaaaa gatattgctgcacatattaaaaaagaatttgatagaaaatatgacccaacttggcactgt gttgtaggaagaaattttggatcttatgtaactcatgaaaccaaaaattttatatatttt tatataggacaagtagctatattattatttaaatctggatga

DBGET integrated database retrieval system