Poecilia latipinna (sailfin molly): 106939898 Help Entry 106939898         CDS       T08005                                  Name (RefSeq) ras-related protein Rab-8A-like   KO K07901   Ras-related protein Rab-8A Organism plai  Poecilia latipinna (sailfin molly) Pathway plai04140   Autophagy - animal plai04144   Endocytosis plai04530   Tight junction Brite KEGG Orthology (KO) [BR:plai00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106939898    04140 Autophagy - animal     106939898   09144 Cellular community - eukaryotes    04530 Tight junction     106939898  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:plai04131]     106939898    03036 Chromosome and associated proteins [BR:plai03036]     106939898   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:plai04147]     106939898    04031 GTP-binding proteins [BR:plai04031]     106939898 Membrane trafficking [BR:plai04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     106939898  Autophagy   Other autophagy associated proteins     106939898 Chromosome and associated proteins [BR:plai03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     106939898 Exosome [BR:plai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106939898   Exosomal proteins of other body fluids (saliva and urine)    106939898   Exosomal proteins of colorectal cancer cells    106939898 GTP-binding proteins [BR:plai04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     106939898 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB MMR_HSR1 DUF3963 DUF6974 Tor_FN3_2nd AAA_7 PduV-EutP Motif Other DBs NCBI-GeneID:  106939898 NCBI-ProteinID:  XP_014877956 Ensembl:  ENSPLAG00000013329 LinkDB All DBs Position Unknown AA seq 176 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMVLG NKCDVNDKRQVSKDRGEKLALEYGIKFMETSAKANINVENVSPFLFFLYFYYSENQ NT seq 531 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacttacgattacttgtttaaactacttttaatcggtgattcgggagtcggg aaaacctgtgtgcttttcagattttcagaagatgccttcaactcaacgtttatctcaact ataggtattgacttcaaaatcagaacaatagaattagatggaaagaagatcaaactacag atatgggacacagcgggacaagagaggttcaggaccatcacaacagcctactacagagga gccatgggcatcatgttagtgtatgacattaccaacgagaagtcctttgacaacatcaag aactggataaggaatatagaagagcatgcctcttcagacgtagagaggatggtcctgggg aataaatgtgatgtcaatgacaagcgacaagtgtccaaagacagaggagagaaactggca ctggagtacggaatcaagttcatggaaacgagtgcaaaagcgaacatcaatgtggagaat gtgagtcccttccttttctttctatacttttattactcagaaaaccagtga

DBGET integrated database retrieval system