Poecilia latipinna (sailfin molly): 106941837 Help Entry 106941837         CDS       T08005                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism plai  Poecilia latipinna (sailfin molly) Pathway plai04010   MAPK signaling pathway plai04068   FoxO signaling pathway plai04081   Hormone signaling plai04114   Oocyte meiosis plai04140   Autophagy - animal plai04150   mTOR signaling pathway plai04810   Regulation of actin cytoskeleton plai04910   Insulin signaling pathway plai04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:plai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106941837    04068 FoxO signaling pathway     106941837    04150 mTOR signaling pathway     106941837   09133 Signaling molecules and interaction    04081 Hormone signaling     106941837  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106941837   09143 Cell growth and death    04114 Oocyte meiosis     106941837   09142 Cell motility    04810 Regulation of actin cytoskeleton     106941837  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     106941837    04914 Progesterone-mediated oocyte maturation     106941837  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:plai04052]     106941837 Cytokines and neuropeptides [BR:plai04052]  Neuropeptides   Unclassified    106941837 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  106941837 NCBI-ProteinID:  XP_014880451 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MARVPWTFSMLFLLVLHSPGASLAPNQHLCGSHLVDALYFICGERGFYNSPSRVHKRDLE NLLGFLAKRARAEERLRRVLAARDEPKVKRGIVEQCCHKPCSIHHLEDYCN NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagggtaccatggacattctccatgctgttcctgcttgtgctccactctccaggg gcctcgttggccccaaaccagcacctgtgtggctctcacctggtcgacgccctctatttc atttgtggggagcgaggattttacaacagtccgagccgagtccacaagcgggacctggag aatctgcttgggttcctggcgaaaagggccagagcggaggagcggctgcggagggttctg gctgcccgtgacgagcccaaggtgaagagaggcatcgtggagcagtgctgccataagccg tgcagcattcaccacctggaggactactgcaactga

DBGET integrated database retrieval system