Poecilia latipinna (sailfin molly): 106946366 Help Entry 106946366         CDS       T08005                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism plai  Poecilia latipinna (sailfin molly) Pathway plai03082   ATP-dependent chromatin remodeling plai04217   Necroptosis Brite KEGG Orthology (KO) [BR:plai00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     106946366  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     106946366  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:plai03036]     106946366   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:plai04147]     106946366 Chromosome and associated proteins [BR:plai03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106946366 Exosome [BR:plai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106946366 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  106946366 NCBI-ProteinID:  XP_014886128 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAAKAK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggaaagaccggtggcaaagccagagctaaggccaagacccgctcatcc cgtgcggggctccagttcccagtgggccgtgttcacaggctgctgaggaaaggaaactac gccgagcgcgtcggcgccggagctcctgtctatctggcggcggtgctcgagtacctgacc gctgagatcctggagctggctggaaacgctgcccgcgacaacaagaagaccaggatcatt ccccgtcacctgcagttggccgtccgcaacgacgaggagctcaacaagctgctgggtgga gtcaccatcgctcagggtggtgttctccccaacatccaggctgtcctgctgcccaagaag accgagaaggcagcgaaggccaagtaa

DBGET integrated database retrieval system