Poecilia latipinna (sailfin molly): 106946477 Help Entry 106946477         CDS       T08005                                  Name (RefSeq) permeability factor 2-like   KO K10030   interleukin 8 Organism plai  Poecilia latipinna (sailfin molly) Pathway plai04060   Cytokine-cytokine receptor interaction plai04218   Cellular senescence plai04620   Toll-like receptor signaling pathway plai04621   NOD-like receptor signaling pathway plai04622   RIG-I-like receptor signaling pathway plai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:plai00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106946477  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     106946477  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106946477    04621 NOD-like receptor signaling pathway     106946477    04622 RIG-I-like receptor signaling pathway     106946477  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106946477  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:plai04052]     106946477    00536 Glycosaminoglycan binding proteins [BR:plai00536]     106946477 Cytokines and neuropeptides [BR:plai04052]  Cytokines   Chemokines    106946477 Glycosaminoglycan binding proteins [BR:plai00536]  Heparan sulfate / Heparin   Chemokines    106946477 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  106946477 NCBI-ProteinID:  XP_014886310 Ensembl:  ENSPLAG00000004400 UniProt:  A0A3B3TQX1 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MKLCVVFVLTALLVLADGMPPISRDLNTHCRCLQVESRIIPAENLKSIKLVPEGPNCAKT EVIAGLVSGEKVCLNPQSAWVKKLVQFVLEKQTQKKRAAPKTKA NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcgttgtgtttgtgctgacggccctgctggtgctcgctgacggaatgccg cccatcagcagggatctcaacacgcactgcaggtgcctgcaggtcgagtccaggatcatc ccagcggagaacctgaagagcatcaagctggtccccgaggggcccaactgcgccaaaacg gaagtcatagccgggctggtgagcggggagaaggtgtgtctcaaccctcagtccgcctgg gtgaagaagctggtccagtttgtcctggagaaacagacccagaagaagagagccgctccc aagacgaaggcatga

DBGET integrated database retrieval system