Poecilia latipinna (sailfin molly): 106948486 Help Entry 106948486         CDS       T08005                                  Symbol arf6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism plai  Poecilia latipinna (sailfin molly) Pathway plai04144   Endocytosis plai04517   IgSF CAM signaling plai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:plai00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     106948486 (arf6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106948486 (arf6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106948486 (arf6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:plai04131]     106948486 (arf6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:plai04147]     106948486 (arf6)    04031 GTP-binding proteins [BR:plai04031]     106948486 (arf6) Membrane trafficking [BR:plai04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     106948486 (arf6)   Arf GTPases and associated proteins    Arf GTPases     106948486 (arf6) Exosome [BR:plai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106948486 (arf6)   Exosomal proteins of colorectal cancer cells    106948486 (arf6) GTP-binding proteins [BR:plai04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     106948486 (arf6) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like Motif Other DBs NCBI-GeneID:  106948486 NCBI-ProteinID:  XP_014889675 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MGKMLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAMILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaaatgctgtcaaaaatcttcggcaacaaggagatgagaatactaatgctcgga cttgatgctgctggaaagacaacaatcctttacaaactgaaactcggacagtctgtgacc acaatccccacagtgggcttcaatgtggaaactgtcacttacaaaaatgtcaagttcaac gtctgggacgtaggaggccaggacaagatccgtcccctgtggcgacactactacacaggg acccagggcttaatttttgtggtggattgcgcagacagggatcgcattgacgaagcgaga caggaacttcaccgcatcatcaatgaccgcgagatgagagatgccatgatcttgatattt gccaataagcaagaccttccggacgccatgaagccgcatgaaatccaagagaagctcgga ttgacccggatcagagataggaattggtatgttcagccctcctgtgcgaccacaggtgat ggactgtatgagggtctgacatggttaacttcaaattacaagtcttaa

DBGET integrated database retrieval system