Poecilia latipinna (sailfin molly): 106953249 Help Entry 106953249         CDS       T08005                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism plai  Poecilia latipinna (sailfin molly) Pathway plai04137   Mitophagy - animal plai04140   Autophagy - animal plai04144   Endocytosis plai04145   Phagosome plai04148   Efferocytosis plai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:plai00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106953249 (rab7a)    04145 Phagosome     106953249 (rab7a)    04140 Autophagy - animal     106953249 (rab7a)    04137 Mitophagy - animal     106953249 (rab7a)    04148 Efferocytosis     106953249 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106953249 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:plai04131]     106953249 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:plai04147]     106953249 (rab7a)    04031 GTP-binding proteins [BR:plai04031]     106953249 (rab7a) Membrane trafficking [BR:plai04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     106953249 (rab7a) Exosome [BR:plai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106953249 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    106953249 (rab7a)   Exosomal proteins of colorectal cancer cells    106953249 (rab7a)   Exosomal proteins of bladder cancer cells    106953249 (rab7a) GTP-binding proteins [BR:plai04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     106953249 (rab7a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 AAA_5 G-alpha ATPase_2 NACHT NB-ARC SRPRB AAA_14 ATP-synt_ab MCM ABC_tran Motif Other DBs NCBI-GeneID:  106953249 NCBI-ProteinID:  XP_014897346 Ensembl:  ENSPLAG00000002799 UniProt:  A0A3B3V308 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVPTKRAQLWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERARPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagttctactcaaagtcatcatccttggagactctggagttggg aagacctcgctaatgaaccagtatgtgaataagaagttcagcaaccagtacaaagccacg attggcgctgattttctgacgaaagaagtcatggtggatgacagacttgtcacaatgcag atttgggacacagcaggtcaggagaggttccagtctttgggtgtagctttctaccgtgga gcagactgctgtgtgctggtgttcgatgtgaccgcacccaacaccttcaagaccctagac agctggagagacgagttcttgatccaggccagcccacgagacccagagaatttccctttt gtggtgctgggcaacaagattgacctggagaacagacaggtaccaaccaagcgggcacag ctttggtgtcagagcaagaacaacatcccatatttcgagaccagcgccaaggaggcaatc aacgtggagcaagccttccagactatcgcacgcaacgctcttaaacaggaaaccgaagtg gagttgtacaacgagttccccgagccaataaagctggacaggaacgagcgagccaggcct tcagcagagacctgcagctgctga

DBGET integrated database retrieval system