Poecilia latipinna (sailfin molly): 106953713 Help Entry 106953713         CDS       T08005                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism plai  Poecilia latipinna (sailfin molly) Pathway plai04010   MAPK signaling pathway plai04012   ErbB signaling pathway plai04068   FoxO signaling pathway plai04137   Mitophagy - animal plai04140   Autophagy - animal plai04144   Endocytosis plai04150   mTOR signaling pathway plai04210   Apoptosis plai04218   Cellular senescence plai04370   VEGF signaling pathway plai04371   Apelin signaling pathway plai04510   Focal adhesion plai04540   Gap junction plai04625   C-type lectin receptor signaling pathway plai04810   Regulation of actin cytoskeleton plai04910   Insulin signaling pathway plai04912   GnRH signaling pathway plai04916   Melanogenesis plai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:plai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106953713 (hras)    04012 ErbB signaling pathway     106953713 (hras)    04370 VEGF signaling pathway     106953713 (hras)    04371 Apelin signaling pathway     106953713 (hras)    04068 FoxO signaling pathway     106953713 (hras)    04150 mTOR signaling pathway     106953713 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106953713 (hras)    04140 Autophagy - animal     106953713 (hras)    04137 Mitophagy - animal     106953713 (hras)   09143 Cell growth and death    04210 Apoptosis     106953713 (hras)    04218 Cellular senescence     106953713 (hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     106953713 (hras)    04540 Gap junction     106953713 (hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     106953713 (hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106953713 (hras)   09152 Endocrine system    04910 Insulin signaling pathway     106953713 (hras)    04912 GnRH signaling pathway     106953713 (hras)    04916 Melanogenesis     106953713 (hras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106953713 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:plai04131]     106953713 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:plai04147]     106953713 (hras)    04031 GTP-binding proteins [BR:plai04031]     106953713 (hras) Membrane trafficking [BR:plai04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     106953713 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     106953713 (hras) Exosome [BR:plai04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    106953713 (hras)   Exosomal proteins of colorectal cancer cells    106953713 (hras) GTP-binding proteins [BR:plai04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106953713 (hras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin nSTAND3 CbiA Motif Other DBs NCBI-GeneID:  106953713 NCBI-ProteinID:  XP_014898156 Ensembl:  ENSPLAG00000003379 UniProt:  A0A3B3TNG1 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTNSFEDILQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtggtgggagctggaggcgtgggcaagagtgcgctcacc atccagctcatccagaaccactttgtggatgaatatgaccctaccatagaggactcctac cggaagcaagtggtgatcgacggggagacatgcttgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggatcagtatatgagaacaggagagggcttcctctgc gtctttgccatcaacaacaccaattcttttgaggacattctccagtacagagaacagatc aagcgcgtgaaagactctgatgatgtacccatggtgcttgtgggaaacaaatgtgacctc ccagcacgcacagtggacacaaggcaagcccaggagcttgctcgctcctacgggatccct tacattgagacctcggctaagacacgacagggagtggaggatgccttctacacactggtg agggaaataaggcagcacaagctgaggaagctgaacccacctgatgagagcggccaggac tgtatgagttgcagatgtgtggtatcgtga

DBGET integrated database retrieval system