Poecilia latipinna (sailfin molly): 106954697 Help Entry 106954697         CDS       T08005                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism plai  Poecilia latipinna (sailfin molly) Pathway plai04382   Cornified envelope formation plai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:plai00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     106954697  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106954697  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:plai04147]     106954697 Exosome [BR:plai04147]  Exosomal proteins   Exosomal proteins of microglial cells    106954697 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EH DEK_C Motif Other DBs NCBI-GeneID:  106954697 NCBI-ProteinID:  XP_014899883 Ensembl:  ENSPLAG00000019110 UniProt:  A0A3B3VW76 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSDLETAMELLIVVFHRYASKDGRAGTLSRRELRQLMENELSNFLKSQKDPGAIDKIMK DLDANGDGQVDFEEFVALVVGLSVACEQCYKMHKGLK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccctctgacctggaaacagcaatggagctgctcatcgtggtgttccaccgttacgcc tccaaggacggccgagcagggactctgagccggcgggagctcaggcagctgatggagaac gagctgtctaacttccttaagtctcagaaggaccctggtgccatcgataagataatgaag gacctggacgccaatggtgacggccaggtggactttgaggagtttgttgctctggtagtt ggactgtctgttgcctgtgagcagtgctataagatgcacaaaggactgaaatag

DBGET integrated database retrieval system