Poecilia latipinna (sailfin molly): 106954772 Help Entry 106954772         CDS       T08005                                  Symbol rhebl1 Name (RefSeq) GTPase RhebL1   KO K07208   Ras homolog enriched in brain Organism plai  Poecilia latipinna (sailfin molly) Pathway plai04140   Autophagy - animal plai04150   mTOR signaling pathway plai04218   Cellular senescence plai04910   Insulin signaling pathway plai05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:plai00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     106954772 (rhebl1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106954772 (rhebl1)   09143 Cell growth and death    04218 Cellular senescence     106954772 (rhebl1)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     106954772 (rhebl1)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     106954772 (rhebl1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:plai04031]     106954772 (rhebl1) GTP-binding proteins [BR:plai04031]  Small (monomeric) G-proteins   Ras Family    Rheb     106954772 (rhebl1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc MMR_HSR1 Arf GTP_EFTU RsgA_GTPase RhoGAP_pG1_pG2 AAA_14 Motif Other DBs NCBI-GeneID:  106954772 NCBI-ProteinID:  XP_014899999 Ensembl:  ENSPLAG00000015650 UniProt:  A0A3B3UI50 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MPQPKYRKIAVIGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFNKMVNVKGQDFNLQLVD TAGQDEYSIFPQSHSMDIHGYVLVYSVTSMKSFEVVQVLHDKLLDMVGKIQVPTVLVGNK KDLHMERVIKPEEGKKLADSWGAAFMESSAKENETAVEVFKRIILEMEKADGNAPPEEKK CAVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcctcaaccaaaatacagaaagatcgcggtcataggttaccggtccgtagggaagtcg tctcttacgatacagtttgttgaaggacagtttgtcgactcctatgacccaaccattgaa aacacatttaacaaaatggtcaacgtgaaaggtcaggacttcaatctgcagctagtcgac acagccggacaggatgagtactcaatttttccacagtcccactcaatggacatccatggt tatgttctggtctattcagtgacttccatgaaaagttttgaagttgtgcaggttctacac gacaagctgctagacatggttggcaagattcaggtcccaactgttcttgtaggaaacaaa aaagatcttcacatggaaagggttatcaaaccagaggagggcaaaaaactagctgattcc tggggagctgcattcatggagtcttccgccaaagaaaacgagactgctgtggaggttttc aagcgaatcattttggagatggagaaagctgacgggaacgcacctccagaggagaagaag tgtgcagtgatgtaa

DBGET integrated database retrieval system