Poecilia latipinna (sailfin molly): 106955530 Help Entry 106955530         CDS       T08005                                  Name (RefSeq) claudin-19-like   KO K06087   claudin Organism plai  Poecilia latipinna (sailfin molly) Pathway plai03272   Virion - Hepatitis viruses plai04382   Cornified envelope formation plai04514   Cell adhesion molecule (CAM) interaction plai04530   Tight junction Brite KEGG Orthology (KO) [BR:plai00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     106955530  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     106955530  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     106955530  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     106955530  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:plai03037]     106955530    04147 Exosome [BR:plai04147]     106955530 Cilium and associated proteins [BR:plai03037]  Other cilia and associated proteins   Stereociliary proteins    106955530 Exosome [BR:plai04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    106955530   Exosomal proteins of colorectal cancer cells    106955530 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF4064 DUF6535 MFS_1 Motif Other DBs NCBI-GeneID:  106955530 NCBI-ProteinID:  XP_014901255 Ensembl:  ENSPLAG00000012549 UniProt:  A0A3B3VL07 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MASSGLQIVGFLLSLVGVSATIAATFMVEWGKESQAKHRTYDGLWMSCSGTSERATCENY KYLLKLPIEVQVTRALILVSLFLSAMALIVSILGMKCTRFMDAMPQSKVKAAVCGGGLFI LAGILTIIVTSWYVSRMVEVNEKAHRLQK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccagctctggactgcagatcgttggttttctcctctccttagttggagtctctgct actattgccgctactttcatggtcgagtggggaaaggagagtcaagcaaaacaccgcacc tatgacggtctgtggatgtcctgcagcggcacctccgagagggccacctgcgaaaattac aagtatctactgaagctcccaattgaggtccaggtcactagagcactgattctggtcagc ctcttcctctccgccatggcgctgattgtctccatactgggaatgaagtgcactcgcttc atggatgccatgccacagagcaaagtcaaagcagctgtctgcggaggagggctgttcata ctcgctggtatcttgaccatcattgttacctcctggtacgtcagtaggatggttgaggtc aacgaaaaggcacatcgactccaaaagtaa

DBGET integrated database retrieval system