Poecilia latipinna (sailfin molly): 106955984 Help Entry 106955984         CDS       T08005                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism plai  Poecilia latipinna (sailfin molly) Pathway plai03272   Virion - Hepatitis viruses plai04382   Cornified envelope formation plai04514   Cell adhesion molecules plai04530   Tight junction Brite KEGG Orthology (KO) [BR:plai00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     106955984  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     106955984  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     106955984  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     106955984  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:plai03037]     106955984    04147 Exosome [BR:plai04147]     106955984    04515 Cell adhesion molecules [BR:plai04515]     106955984 Cilium and associated proteins [BR:plai03037]  Other cilia and associated proteins   Stereociliary proteins    106955984 Exosome [BR:plai04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    106955984   Exosomal proteins of colorectal cancer cells    106955984 Cell adhesion molecules [BR:plai04515]  Immunoglobulin superfamily   L1 family    106955984 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin L_HMGIC_fpl Claudin_2 Trp_oprn_chp Zip Motif Other DBs NCBI-GeneID:  106955984 NCBI-ProteinID:  XP_014901983 LinkDB All DBs Position Unknown AA seq 164 aa AA seqDB search MYEGLWMNCVKQSTGQLQCKAYDSLQVLPSDLQAGRPMTVISCILCGLSLLVLLFGADFT TCVQNEEAKPKLSLMAAVGLLLAGLLVIIPVSWSAHNTDTHDQMYPTSEKRELGVCIYIG WAAGVILILAGGLLCCFSRSRSNSSGGTATYYSNSASAAYDDVM NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgtatgaaggtctctggatgaactgtgtgaagcagagcactggacagctgcagtgcaaa gcgtacgactccttgcaggtgttaccctctgaccttcaggccggccggcccatgaccgtc atcagctgcatcctctgtgggctcagcctcctcgtcctgctctttggtgccgacttcacc acatgtgttcagaacgaagaggccaagcccaaactcagcctgatggccgcagtgggcctg ctgctggccggcctgctggtgatcatcccggtcagctggtcggcacacaacactgacaca cacgaccaaatgtacccgacttccgagaagagagaactgggagtgtgcatctatatcggc tgggcagctggtgtgatactgatcctggctggaggtctgctctgctgcttcagcagatcc agatccaacagctctggaggaaccgccacctactacagcaacagcgcttcagctgcatac gacgacgtcatgtag

DBGET integrated database retrieval system