Poecilia latipinna (sailfin molly): 106958654 Help Entry 106958654         CDS       T08005                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism plai  Poecilia latipinna (sailfin molly) Pathway plai04060   Cytokine-cytokine receptor interaction plai04218   Cellular senescence plai04620   Toll-like receptor signaling pathway plai04621   NOD-like receptor signaling pathway plai04622   RIG-I-like receptor signaling pathway plai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:plai00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106958654  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     106958654  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106958654    04621 NOD-like receptor signaling pathway     106958654    04622 RIG-I-like receptor signaling pathway     106958654  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106958654  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:plai04052]     106958654    00536 Glycosaminoglycan binding proteins [BR:plai00536]     106958654 Cytokines and neuropeptides [BR:plai04052]  Cytokines   Chemokines    106958654 Glycosaminoglycan binding proteins [BR:plai00536]  Heparan sulfate / Heparin   Chemokines    106958654 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 DUF4969 Motif Other DBs NCBI-GeneID:  106958654 NCBI-ProteinID:  XP_014906153 Ensembl:  ENSPLAG00000022653 UniProt:  A0A3B3UZF8 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MKKISIITLSVLIFLSFLATSKGMSLRSLGVELHCRCIQTESRPIGRHIEKVELIPANSH CEETEIIATLKKDGQEVCLDPEAPWVKKVIQRIMANKKR NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaagaaaatcagcattattaccctctctgtcttaatcttcttgtccttcctcgccacc agcaaaggaatgagtctgagaagcttaggagtggagctgcactgtcgctgcatccagact gagagcagacccatagggcgccacatagagaaagtggagctgattcctgccaactctcac tgcgaggagaccgagatcattgccactctaaaaaaagatggccaagaagtttgcctggac cctgaggctccatgggtcaagaaagtaattcagaggatcatggcaaacaagaaacgatga

DBGET integrated database retrieval system