Poecilia latipinna (sailfin molly): 106960333 Help Entry 106960333         CDS       T08005                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism plai  Poecilia latipinna (sailfin molly) Pathway plai04081   Hormone signaling plai04144   Endocytosis plai04150   mTOR signaling pathway plai04270   Vascular smooth muscle contraction plai04310   Wnt signaling pathway plai04350   TGF-beta signaling pathway plai04510   Focal adhesion plai04520   Adherens junction plai04530   Tight junction plai04621   NOD-like receptor signaling pathway plai04625   C-type lectin receptor signaling pathway plai04810   Regulation of actin cytoskeleton plai05100   Bacterial invasion of epithelial cells plai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:plai00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     106960333    04350 TGF-beta signaling pathway     106960333    04150 mTOR signaling pathway     106960333   09133 Signaling molecules and interaction    04081 Hormone signaling     106960333  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106960333   09144 Cellular community - eukaryotes    04510 Focal adhesion     106960333    04520 Adherens junction     106960333    04530 Tight junction     106960333   09142 Cell motility    04810 Regulation of actin cytoskeleton     106960333  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     106960333    04625 C-type lectin receptor signaling pathway     106960333   09153 Circulatory system    04270 Vascular smooth muscle contraction     106960333  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106960333    05100 Bacterial invasion of epithelial cells     106960333  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:plai04131]     106960333   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:plai04147]     106960333    04031 GTP-binding proteins [BR:plai04031]     106960333 Membrane trafficking [BR:plai04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     106960333 Exosome [BR:plai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106960333   Exosomal proteins of other body fluids (saliva and urine)    106960333   Exosomal proteins of colorectal cancer cells    106960333   Exosomal proteins of bladder cancer cells    106960333 GTP-binding proteins [BR:plai04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     106960333 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  106960333 NCBI-ProteinID:  XP_014908866 Ensembl:  ENSPLAG00000016783 UniProt:  A0A3B3UKW6 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDDHTRRELAKMKQEPVKPEDGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKSNKCVLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaattaggaaaaagctggttatagtgggagatggagcctgtgggaagacctgc ctgctcattgtgttcagcaaggaccagtttcctgaagtctatgtgcccacagtgtttgag aactacgtcgctgacattgaagttgacggaaaacaggttgaattagcgctctgggacaca gcaggtcaagaggactatgaccgactccgcccactctcttatccagacactgatgtcata ctcatgtgcttctccatcgacagcccagacagtcttgagaacatccctgagaagtggacc cctgaggtgaaacacttctgccccaacgttcccatcatactggtgggaaataaaaaggat ttgcgtaacgatgatcacactcggagggagctagctaaaatgaagcaggaacccgtgaaa ccagaagatggccgggatatggccaacaggatcggtgccttcggatacatggagtgctct gcaaaaacaaaggatggcgtgagggaagtgttcgagatggccaccagggctgcactacag gccaggcggggaaagaagagcaataaatgcgtcctactgtaa

DBGET integrated database retrieval system