Poecilia latipinna (sailfin molly): 106960645 Help Entry 106960645         CDS       T08005                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism plai  Poecilia latipinna (sailfin molly) Pathway plai04010   MAPK signaling pathway plai04137   Mitophagy - animal plai04140   Autophagy - animal plai04218   Cellular senescence plai04371   Apelin signaling pathway plai04625   C-type lectin receptor signaling pathway plai04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:plai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106960645 (rras2)    04371 Apelin signaling pathway     106960645 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106960645 (rras2)    04137 Mitophagy - animal     106960645 (rras2)   09143 Cell growth and death    04218 Cellular senescence     106960645 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     106960645 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106960645 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:plai04147]     106960645 (rras2)    04031 GTP-binding proteins [BR:plai04031]     106960645 (rras2) Exosome [BR:plai04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    106960645 (rras2)   Exosomal proteins of bladder cancer cells    106960645 (rras2) GTP-binding proteins [BR:plai04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106960645 (rras2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SLFN-g3_helicase ATP_bind_1 FeoB_N Motif Other DBs NCBI-GeneID:  106960645 NCBI-ProteinID:  XP_014909337 Ensembl:  ENSPLAG00000008614 UniProt:  A0A3B3U1E3 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKTGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctggctggaaggacggctcggtgcaggagaagtaccgtctggtcgtggtcggaggc ggtggcgtcgggaaatcagccttgactatccagtttattcagtcatactttgtcaccgac tatgatcctacgatcgaagactcttacaccaagcagtgcgtgattgatgaaaggccggcc aggctggacatcctcgacacggctggacaggaagagttcggagccatgcgagaacaatac atgaggacaggggagggcttcctgctcgtcttctcagtcactgacagaggaagctttgaa gaaatctacaaattccaaagacagattctgcgagtcaaagacagagatgaattccccatg atcctcgtaggcaacaaggcagatctggagctgcagagacaagtaacccaggaagagggc cagcagctggccagacagctaaaagtcacatatatggaggcttcagctaaaatccgtatg aacgtagaccaggcttttcacgagctggttagggtaatcaggaaattccaagaacaagaa tgtccaccgtcgccggagcctacgagaaaagagaaagacaaaaccggctgccattgtgtg atcgtctga

DBGET integrated database retrieval system