Poecilia latipinna (sailfin molly): 106960645 Help Entry 106960645         CDS       T08005                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism plai  Poecilia latipinna (sailfin molly) Pathway plai04010   MAPK signaling pathway plai04137   Mitophagy - animal plai04140   Autophagy - animal plai04218   Cellular senescence plai04371   Apelin signaling pathway plai04519   Cadherin signaling plai04625   C-type lectin receptor signaling pathway plai04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:plai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106960645 (rras2)    04371 Apelin signaling pathway     106960645 (rras2)   09133 Signaling molecules and interaction    04519 Cadherin signaling     106960645 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106960645 (rras2)    04137 Mitophagy - animal     106960645 (rras2)   09143 Cell growth and death    04218 Cellular senescence     106960645 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     106960645 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106960645 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:plai04147]     106960645 (rras2)    04031 GTP-binding proteins [BR:plai04031]     106960645 (rras2) Exosome [BR:plai04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    106960645 (rras2)   Exosomal proteins of bladder cancer cells    106960645 (rras2) GTP-binding proteins [BR:plai04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106960645 (rras2) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SLFN-g3_helicase ATP_bind_1 RHG35-p190PhoGP_pG1 FeoB_N Motif Other DBs NCBI-GeneID:  106960645 NCBI-ProteinID:  XP_014909337 Ensembl:  ENSPLAG00000008614 UniProt:  A0A3B3U1E3 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKTGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctggctggaaggacggctcggtgcaggagaagtaccgtctggtcgtggtcggaggc ggtggcgtcgggaaatcagccttgactatccagtttattcagtcatactttgtcaccgac tatgatcctacgatcgaagactcttacaccaagcagtgcgtgattgatgaaaggccggcc aggctggacatcctcgacacggctggacaggaagagttcggagccatgcgagaacaatac atgaggacaggggagggcttcctgctcgtcttctcagtcactgacagaggaagctttgaa gaaatctacaaattccaaagacagattctgcgagtcaaagacagagatgaattccccatg atcctcgtaggcaacaaggcagatctggagctgcagagacaagtaacccaggaagagggc cagcagctggccagacagctaaaagtcacatatatggaggcttcagctaaaatccgtatg aacgtagaccaggcttttcacgagctggttagggtaatcaggaaattccaagaacaagaa tgtccaccgtcgccggagcctacgagaaaagagaaagacaaaaccggctgccattgtgtg atcgtctga

DBGET integrated database retrieval system