KEGG   Planococcus sp. 11815: M1Q06_13255
Entry
M1Q06_13255       CDS       T11305                                 
Symbol
atpD
Name
(GenBank) F0F1 ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
plao  Planococcus sp. 11815
Pathway
plao00190  Oxidative phosphorylation
plao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plao00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    M1Q06_13255 (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:plao00194]
    M1Q06_13255 (atpD)
Enzymes [BR:plao01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     M1Q06_13255 (atpD)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     M1Q06_13255 (atpD)
Photosynthesis proteins [BR:plao00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   M1Q06_13255 (atpD)
SSDB
Other DBs
NCBI-ProteinID: XWW49562
LinkDB
Position
complement(2632126..2633541)
AA seq 471 aa
MNTGHVLQVMGPVVDVKFSNGQLPAIYNALTVNIDRPNQAQTTLTLEVALHLGDDTVRTI
AMESTDGLQRGSAVTDLGRAISVPVGDVTLGRVFNVLGEVIDLGEEIPASERRDPIHRSA
PTFEHLSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGL
SVFAGVGERTREGNDLFHEMSESGVIKKTSMVFGQMNEPPGARMRVALTGLTMAEYFRDE
QGADVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITTTSAGSVTS
IQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGAE
HYGVSRQVQETLQRYRELQDIIAILGMDELSDEDKLTVNRARRVQNFLSQNFHVAEQFTG
QKGSYVPVQETIKGFQEILAGKYDHLPEDAFRLVGRIEEVIEKAKGMGVQV
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgaacacaggacacgttcttcaggttatgggtccggttgtagacgttaagttttccaat
ggccaacttccagcgatctacaacgccctaaccgttaatattgatcgtcccaatcaagct
caaactactttgactcttgaagtagctttgcaccttggcgacgacacagttcgtaccatc
gcaatggaatccactgacggattgcagcgcggttcagcagtaaccgatttgggcagagca
atttctgttcctgtcggagatgttacacttggccgagtattcaacgtacttggtgaagta
atcgacttgggtgaggaaatcccggcatcagaacgccgcgacccgattcaccgttcagct
cctacgtttgagcatctttccactgaagttgaaattcttgaaactggtatcaaagttgtt
gacttgcttgccccttacatcaaaggtggtaaaatcggcctcttcggtggtgccggtgta
ggtaaaactgttttgatccaggaattgatcaacaacatcgcacaagaacacggcggtctt
tctgtattcgctggtgttggcgagcgtacgcgcgaaggaaacgacttgttccacgagatg
agcgaatccggcgttatcaagaaaacttcaatggtcttcggccagatgaacgagccgcct
ggcgcacgtatgcgtgttgctttgacaggtttgactatggctgaatatttccgtgatgag
caaggcgcagacgttcttttgttcatcgataacattttccgcttcacgcaagcaggttct
gaagtatccgcccttcttggccgtatgccatcagcggttggttaccagccgacacttgcg
actgaaatgggtcaattgcaagagcgtatcacaacaactagcgctggttctgtaacatcg
atccaggcaatctatgttccagccgatgactatacggatccggctccggcaacaacgttt
gcccaccttgatgcaacaactaaccttgagcgtaaactttctgagatgggtatctaccca
gcggtggatccacttgcttctacttcccgcgcattgtctcctgaaatcgtcggcgcagaa
cactacggtgtttcacgtcaggttcaagaaactttgcagcgttacagagagcttcaggat
atcattgcgatccttggtatggatgaattgagcgatgaggacaagctgacggttaaccgt
gcacgccgtgtccaaaacttcttgtctcaaaacttccacgttgctgaacagttcactggc
caaaaaggctcgtatgttccagttcaggaaacgatcaaaggcttccaggaaatccttgca
ggcaaatacgatcatcttccggaagatgctttccgcctagtcggccgcatcgaagaagtt
atcgaaaaagccaaaggcatgggcgtacaagtctaa

DBGET integrated database retrieval system