Parasalinivibrio latis: NF212_01560 Help Entry NF212_01560       CDS       T11132                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism plas  Parasalinivibrio latis Pathway plas02024   Quorum sensing plas03018   RNA degradation Brite KEGG Orthology (KO) [BR:plas00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     NF212_01560 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NF212_01560 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:plas03019]     NF212_01560 (hfq)    03036 Chromosome and associated proteins [BR:plas03036]     NF212_01560 (hfq) Messenger RNA biogenesis [BR:plas03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      NF212_01560 (hfq) Chromosome and associated proteins [BR:plas03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NF212_01560 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  WWE58866 LinkDB All DBs Position 1:301177..301458 Genome browser AA seq 93 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS TVVPARPVNHHHNNTTGGHPGQGERPQQDKTEE NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatcactacaagacccatttttgaatgcactccgtcgtgaacgggta cctgtttcaatctatctggtaaacggaattaagttgcaaggtcagattgaatcatttgat cagtttgtgatcctgctgaaaaacaccgtaaaccaaatggtgtacaagcacgccatctca actgtggtaccagcccgtccggtaaatcaccaccataacaacaccaccggcggccatcca ggccagggcgagcgtccacaacaagacaaaaccgaggagtaa

DBGET integrated database retrieval system