Plantactinospora sp. BB1: C6W10_06060 Help Entry C6W10_06060       CDS       T05391                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plat  Plantactinospora sp. BB1 Pathway plat00998   Biosynthesis of various antibiotics plat01100   Metabolic pathways plat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plat00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C6W10_06060    00074 Mycolic acid biosynthesis     C6W10_06060   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C6W10_06060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AVT36099 LinkDB All DBs Position complement(1438709..1438975) Genome browser AA seq 88 aa AA seqDB search MSSTTPTTSTDIDREQVKEIVCEILEIDADEVTETSLFKEDHGADSLLAIEILAALERNL HVTIDQAELSRMVNLQGVYAVVGEASNA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagcagcacgacccccaccaccagcaccgacatcgaccgcgagcaggtcaaggagatc gtctgcgagattctggaaatcgacgcggacgaggtcaccgagaccagtctgttcaaagag gaccacggtgcggactcgctgctcgcgatcgaaattctcgccgccctggagcggaatctg cacgtcacgatcgaccaggcggaactgagccgaatggtgaatctgcagggcgtttacgcc gtcgtcggcgaggcgtcgaacgcctga

DBGET integrated database retrieval system