Plantactinospora sp. BB1: C6W10_27465 Help Entry C6W10_27465       CDS       T05391                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plat  Plantactinospora sp. BB1 Pathway plat00998   Biosynthesis of various antibiotics plat01100   Metabolic pathways plat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plat00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C6W10_27465    00074 Mycolic acid biosynthesis     C6W10_27465   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C6W10_27465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AVT39560 UniProt:  A0A2R4FPY7 LinkDB All DBs Position 6292777..6293016 Genome browser AA seq 79 aa AA seqDB search MTRDEITAGLAEILEEVAGVSPDDVAEEKSFTDDLDVDSLSMVEVVVAAEEKFGVKIPDN DVQNLKTVGDAVAYIEAQS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgacccgtgacgagatcaccgccggcctcgccgagatcctcgaagaggtcgccggggtg agcccggacgacgtcgccgaggagaagtcgttcaccgacgacctcgacgtcgactcgctc tccatggtcgaggtcgtggtggccgccgaggagaagttcggcgtcaagatcccggacaac gacgtccagaacctcaagaccgtcggcgacgccgtcgcctacatcgaggcacagtcctga

DBGET integrated database retrieval system