Pseudomonas lalucatii: I0D68_21310 Help Entry I0D68_21310       CDS       T10193                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism plau  Pseudomonas lalucatii Brite KEGG Orthology (KO) [BR:plau00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:plau03032]     I0D68_21310    03036 Chromosome and associated proteins [BR:plau03036]     I0D68_21310    03400 DNA repair and recombination proteins [BR:plau03400]     I0D68_21310 DNA replication proteins [BR:plau03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     I0D68_21310 Chromosome and associated proteins [BR:plau03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     I0D68_21310 DNA repair and recombination proteins [BR:plau03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       I0D68_21310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 SSPI HTH_IclR DUF7387 HTH_20 HTH_30 TrmB Motif Other DBs NCBI-ProteinID:  QVM87558 LinkDB All DBs Position 4441742..4442020 Genome browser AA seq 92 aa AA seqDB search MAMTKDQLISDIAEAIDTPKSTVRAALEQLSEIVSDALENGDEITLPGIGKLKVGERPAR TGRNPQTGKAIEIAAKKVVKYVPAKALTDAIN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggccatgaccaaagaccagctgatcagcgatatcgccgaagccatcgacaccccgaag agcaccgtgcgtgctgccctcgagcaactcagcgagatcgtcagcgacgccctggaaaat ggcgacgaaatcaccctgcctggcatcggcaagttgaaggtcggcgaacgtccggcccgc accggccgcaacccgcagacgggcaaggcgatcgagatcgcggcgaagaaggtggtcaag tacgtgccggccaaggccctgaccgacgcgatcaactaa

DBGET integrated database retrieval system