Planococcus halotolerans: DNR44_006725
Help
Entry
DNR44_006725 CDS
T06390
Name
(GenBank) response regulator
KO
K02483
two-component system, OmpR family, response regulator
Organism
play
Planococcus halotolerans
Brite
KEGG Orthology (KO) [BR:
play00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
play02022
]
DNR44_006725
Two-component system [BR:
play02022
]
OmpR family
Unclassified
DNR44_006725
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Trans_reg_C
GlnR_1st
Motif
Other DBs
NCBI-ProteinID:
QHJ70313
LinkDB
All DBs
Position
1298336..1299016
Genome browser
AA seq
226 aa
AA seq
DB search
MHILVVEDNPSVSSMLELFFSKEGITGEFASDGIEGFNKYQQNDYDLLVLDWMLPGMDGI
ALCRKIREQGDQVPIIMLTAKDSESDQVIGFEMGADDYVTKPFSPLTLMARIKAVTRRSQ
KGETVDDQIQTKHFTINKTTREVQKDGTVIENLTPKEYDLLVFLLQHPKQVFSREQLLER
VWGYQFYGDERTVDVHIKRIRKKISGGDQYFHTVWGVGYKFEEQAD
NT seq
681 nt
NT seq
+upstream
nt +downstream
nt
atgcatattttagttgtcgaagataatccgagcgtcagttcaatgctcgaattatttttt
tcaaaagaaggaattaccggggagtttgcttctgatggcatcgaaggattcaataaatat
cagcaaaatgactatgatctgctggtcctggattggatgctgccgggaatggacggcatc
gcattgtgcagaaaaatccgcgagcagggagatcaggtgccgatcatcatgctgacggca
aaagacagcgaatcggatcaggtaatcggctttgagatgggtgcagacgattacgtcaca
aaacctttcagcccgcttactttaatggcgaggatcaaagcggtcaccagacgttcccaa
aaaggggagaccgttgatgatcaaatacagacgaagcatttcacgatcaataaaacaacg
agagaagtacaaaaggatggcactgttatagagaatctcacaccgaaggaatacgatttg
ctcgtgttcctgttgcagcatccgaaacaggtgttcagccgcgaacagctgctggaaaga
gtttggggctatcaattctacggtgatgaacggacggtggacgtccatattaaacggatc
cgcaaaaaaatatccggcggtgaccagtacttccacaccgtttggggagttggctataaa
tttgaagaacaggcggattaa
DBGET
integrated database retrieval system